(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE218

PENCW_10.PE218       Location/Qualifiers
FT   CDS_pept        complement(499214..500314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672165"
FT                   /orf_name="Pc13g02180"
FT                   /product="Pc13g02180 protein"
FT                   /protein_id="CAP91287.1"
FT                   /db_xref="UniParc:UPI00018309EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I4"
FT                   /transl_table=1
FT                   /translation="MGDFTAPGNGISGHYQGTSLGMKITIATLAGVTWYNAFELMILLF
FT                   VTFAEYRGLYFWSLFISSSVGLLPYSLGFLLKFFKITDDIAWFPVTLLTIGWWSMVTGQ
FT                   SIVLYSRLHLVVSNQRVLRRVLIMIVVNAIILHLPTTALTYGTNMADDTTLWTKTYNIM
FT                   EKIQMTGFCIQEFIISGLYIWETVRMLRLDPDRIKRKIQYQLLAINLIIIILDLGLLVA
FT                   EYLDFYIMETMLKGVVYSIKLKLEFAVLGKLIHLVHNHVWKPESFSAPRDLPDFVDATR
FT                   VTSDMTHATHSAIQRRPSRMDADDISIAMFEHLPPDRIRTNSDLSHSWSNEGRAYHVDH
FT                   LPIDFTNPFAHYPRYQSRRGIPEKPG"
     atgggcgatt tcactgctcc cgggaatggc atcagcggtc attaccaggg gacttccctg        60
     ggtatgaaga tcacgatcgc aactcttgcc ggtgtcactt ggtataatgc cttcgagcta       120
     atgatccttc tcttcgtcac cttcgccgaa taccgaggtc tctacttttg gagtttattt       180
     atttcctcct ccgttggtct acttccctac tcgctgggct tcttactcaa atttttcaaa       240
     atcaccgacg acattgcatg gttccctgtc actttgctca ccattggatg gtggtctatg       300
     gtcaccggcc agtcgattgt cctatactcg cgactccact tggtcgtatc aaaccagcga       360
     gtcctacgtc gcgtgttgat catgatcgta gttaacgcaa tcatcctcca tttacccact       420
     accgccctca cctacggtac caacatggcc gacgacacca ccctgtggac caaaacctac       480
     aatatcatgg aaaagatcca aatgacaggc ttctgtatac aggaattcat catctcgggg       540
     ctatacatct gggaaacagt ccgcatgtta cgcctagacc cggaccgtat caagcgcaag       600
     atccagtacc aactactcgc catcaacctc atcatcatca ttctggatct gggcctgctc       660
     gtcgccgagt acttggactt ctacatcatg gaaaccatgc tgaaaggcgt cgtatacagc       720
     atcaagctga agctcgaatt cgccgtcctc ggtaaactca tccacctggt acacaatcac       780
     gtctggaaac ccgaatcttt ctctgcgcca cgcgacctgc ccgatttcgt cgacgcaacc       840
     cgcgtcacct ccgacatgac ccatgccacc cacagcgcca tccaacgcag accttcccgc       900
     atggatgccg acgacatctc aatcgccatg ttcgaacatc taccgcccga ccgcatacgg       960
     accaactccg atctctccca ttcgtggagt aatgagggcc gcgcctatca tgtcgatcat      1020
     ctccccatcg acttcaccaa tccttttgcc cattatccgc gttaccagag tcgtcgcgga      1080
     atacccgaga aaccgggatg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page