(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE219

PENCW_10.PE219       Location/Qualifiers
FT   CDS_pept        complement(501217..502122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949829"
FT                   /orf_name="Pc13g02190"
FT                   /product="Pc13g02190 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP91288.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I5"
FT                   /transl_table=1
FT                   /translation="MGKRIVITGGSGKAGQHIIRYLLQQGHDLLNLDLVPLPAELEERV
FT                   HTLRVDLTNTGQVYSALGSHFHLSEPFREPLGLVPDAVIHMAGYSRNMIVPDEETFRSN
FT                   TSAMYNIIEGASRLGIKKIIIASSITVYGVSYAEGDVDYPSFPVDETVDANPMDTYAIS
FT                   KVCGESIARGFARRYGRDIYILRIGRIVAPEEYKQSMFRSYVENPEKWAPHGWAYIDAR
FT                   DLGQMCDRAVQKDGLGFQIFNAVNDGITNYENTAEFLARVCPGVPVTRELGAREAPICN
FT                   RKIKELLGFREEHHWMKYYE"
     atgggaaaac ggattgtgat cactggaggc tcgggcaaag ccggacaaca cattatcaga        60
     tatctcctcc aacaaggcca tgatctcctg aacctcgacc tcgttcctct ccccgccgag       120
     ctggaagagc gagtccacac cttgcgcgtg gacctgacca acaccggaca ggtctacagc       180
     gcactaggat cccatttcca cctgtcagag ccctttcgtg aaccactggg gctagtcccc       240
     gatgcagtca ttcacatggc cgggtattct cgcaacatga tcgttccaga cgaagaaacc       300
     ttccgcagca acacctcggc aatgtacaac ataatcgaag gcgcttcgcg cctcggcatc       360
     aaaaagatca tcatcgccag ctccatcacc gtctacggag tgagttacgc agagggagat       420
     gtagactatc cctctttccc ggtggatgaa acggtcgacg ccaacccgat ggacacatac       480
     gctatctcga aggtatgcgg tgagagcatt gcgcgtggct ttgcgcggcg gtatggaagg       540
     gacatctata tcttgcgcat tgggcgcatt gtcgctcccg aggagtacaa acagtccatg       600
     ttccgatcat atgttgagaa tccggagaaa tgggcgccgc atggctgggc gtacattgac       660
     gctcgtgatc tcgggcagat gtgtgatcgc gcggtgcaga aggatggact tggatttcag       720
     atctttaatg cggtcaatga cggaattacg aattacgaga acacagccga gttcctagcg       780
     cgggtttgcc ctggtgtccc ggttacgcgc gagttggggg ccagagaggc tcccatctgt       840
     aatcggaaaa ttaaggagct gcttggattt cgggaagagc atcattggat gaagtattat       900
     gaatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page