(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE22

PENCW_10.PE22        Location/Qualifiers
FT   CDS_pept        join(49646..50001,50063..50288,50464..50754,50811..51039,
FT                   51092..51251,51314..55217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948689"
FT                   /orf_name="Pc13g00220"
FT                   /product="Pc13g00220 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91091.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830DBE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H5"
FT                   /transl_table=1
FT                   /translation="MASQRKSHVFRVTGLSRELPDRDLKTAVQRALNDNFTDDERSHIT
FT                   AEVTIVPSCYESDTERAALVQFRGGVPQFLYELRVDPLGDWQVEMGDNDINFDCHFFGF
FT                   TQLYAPDDNEPVVADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMVL
FT                   FAIPHKGLVMDDIQQMLVGDKSHPRERLLQQISSKSDLLIHQLADFKNLIRDRKVVSFY
FT                   ETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDHVEDKVPLHADHSMVVKFDTR
FT                   NAAGYRTAVDKLRQFLKDAPSVVAARFTQTRPKPQPCSTVPFKKDPMFVGRESVISAIN
FT                   ERHRAIGQRHERVALVGLAGVGKTQAAIEYSYRVRESTPDTWVFWIHASNTARLEQGYQ
FT                   QIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLMVLDNADDDGIFFGDNTFNERGPL
FT                   VSFLPQAAHGSMLITSRNGLAARNLVGSDSHVITVQPMNEAESLALLRLRIPAPQSGES
FT                   GESGGDERALVQALECIPLAITQAAAYIANRLPLVTVSAYLRLFHESESKRTRLLQNED
FT                   SADLRRDPSIRYAVMTTWQLSFEQIRQERPAATDLLALMSMFDRQGIPEDLVRHHEQDI
FT                   LDFHDALAPLLSYSLIRLELNERLFDMHRLVQLSVRAWLDMHQQLYGWQAKSRGIMARV
FT                   FPDGEYESWSQCRSLLAHANSVLQSICDVDDKDRLNAAALLSNCGWFLDLQGVYEEAEA
FT                   MHRRALEAREKVLGREHPDTLTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREH
FT                   PNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVNNLGNVLSSQ
FT                   GKYDEAEAMHRRALEGCEEVLGREHPNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGS
FT                   EKVLGREHPHTLASVNNLGNVLSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNN
FT                   LGNVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAM
FT                   HRRDLEGSEKVLGREHPDTFTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREHP
FT                   DTLTSVNNLGLVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTFTSVNNLGDVLSRQG
FT                   KYDEAEAMHRRALEAREKVLGREHPDTLTSVSNLGGVLFSQGKYDEAEAMHRRALEARE
FT                   NVLGREHPNTLTSLSNLGNVLSSQGKYDEAEAMHRRALEARENVLGREHPDTLTSVNNL
FT                   GYILSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNNLGDVLSRQGKYDEAEAMH
FT                   RRALEAREKVLGREHPDTLTSVSNLGDVLSSQGKYDEAEAMHRWALEAREKVLGREHPN
FT                   TLTSVSNFGDVLSSQGKYDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGK
FT                   YDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAMHRRDLEGSEK
FT                   VLGREHPDTFTSVSNLANVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLG
FT                   NVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLGNVLSNQGKYDEAKAIHL
FT                   QDMEGSEKVLGCEHPRILASLNIR"
     atggctagtc agagaaagtc gcatgtcttc cgggtgacag gcctgtcgag ggaactgccc        60
     gatagggatc tcaaaacagc agtgcaacgg gcacttaacg ataactttac cgacgacgag       120
     agatctcata tcacggctga ggtcacaata gtgccgtcat gctacgaaag tgacacagag       180
     agggcggcgc tagtgcagtt tcgcggtggg gtacctcagt tcctctatga gctgagagtc       240
     gatcctcttg gagactggca ggtcgagatg ggagacaacg acatcaactt tgactgccac       300
     ttctttggat ttacccagct ctatgcgccg gacgacaatg agccagtggt tgccgacatc       360
     attgccattg ccggactaga tggacatgcg tatggatcgt ggcaaggaag agggaatctt       420
     ggtcggatgt ggctccgtga cttcctgtcg aaggaccttc cgcagtgccg cactatgata       480
     tacgggtaca actccaagct gtcgagccac ggagtggaca cgatcctcga ctatgggcgg       540
     gagctgatgg aagagatcaa gaaaatccgg aatacgaagg agtgcctggt gagggccatc       600
     cagacgatgg aggaagacca cccggcgatc acgtcgctgc atcgagccac gtacggcatg       660
     gtccttttcg ccatcccaca taaaggattg gtaatggacg atatccagca gatgttagta       720
     ggagataaga gccatccgcg agagcgacta ctacagcaga tctccagtaa atcggacctg       780
     ttaatccacc agctggcgga tttcaaaaat ctaattcggg accgtaaggt agtgagcttc       840
     tatgagacgg agcagacgag gcagttggta ttggactcgg aaagcggacg atggaaacgc       900
     accggggatt ttgtgacgac ggttggcgca gactcggctc ttctccagct ccccgaccat       960
     gtagaggaca aggtgccgct gcatgcagat cactcgatgg tggtcaaatt cgacacgcgc      1020
     aacgcggccg ggtatcgaac ggcggtcgat aaactgcggc agttcttaaa agacgcgcca      1080
     tcggtggtgg cggctcggtt tacgcagacg cgtccgaagc cccagccgtg ctccacggtg      1140
     ccttttaaga aggacccgat gtttgtgggc cgcgaatctg tgatcagtgc gatcaatgaa      1200
     agacataggg cgatcggcca gcgtcacgag cgggtggcat tggtggggtt ggctggcgtt      1260
     ggaaaaaccc aggcagccat cgagtattcc tatcgtgtgc gagaatctac accggacact      1320
     tgggtgtttt ggatccacgc cagcaatacg gcgcggttgg aacagggcta ccagcagatt      1380
     gccacagttg cggagattcc gggacgggac gatccgaaga tcaacattct ccagctcgtg      1440
     tatcagtggt tgtgtgatgc acgcaatggg cgctggctga tggtgctaga taatgcggat      1500
     gacgatggta tctttttcgg tgacaataca ttcaacgaac gagggccgtt ggtgagcttc      1560
     ctgccccagg ccgcccatgg atcaatgctg atcacatcgc gaaatggtct tgcggcacgg      1620
     aatctggtgg ggagcgatag tcatgtgatc acagttcagc caatgaatga ggcagagtcc      1680
     ttggctcttt tacggttaag gattccagcc ccccagtcgg gagagtctgg agagtctgga      1740
     ggggacgaga gggcactagt ccaggcatta gagtgtatcc cattggctat cactcaggct      1800
     gcggcgtata ttgccaaccg gttgccccta gttaccgtct cggcatacct tcggcttttc      1860
     catgaaagcg agtcgaagcg gacgcggctt ctccagaatg aggattctgc ggatctccgg      1920
     cgggatccca gcattcggta tgccgtgatg acaacgtggc agttatcgtt tgagcagatc      1980
     cgtcaggagc ggcctgcggc gaccgatctc ctggcgttga tgagtatgtt cgatcggcag      2040
     ggaatccccg aagatctggt gcgccaccac gagcaagata tcctggactt ccacgatgca      2100
     ttggcgccgc ttctcagcta ttctctgatc cgactagaac taaacgaacg gttgttcgat      2160
     atgcaccgct tggtacagtt atcggtccga gcgtggctgg acatgcacca gcagctttac      2220
     ggctggcagg ccaaatcacg cgggattatg gcacgggtat ttccagatgg cgagtacgag      2280
     agctggtcac aatgtcggtc gctccttgcg catgccaaca gtgtgctgca gtctatatgt      2340
     gacgtagatg ataaagatcg attgaatgct gccgccctct tatctaattg tgggtggttt      2400
     ctagatcttc aaggagttta tgaagaggcg gaagcgatgc atcgacgggc gttggaagca      2460
     cgagagaagg tgcttggacg cgagcatcct gacacgctca ccagtgtcag taaccttggc      2520
     ttagttctct ccagccaagg caaatatgac gaggcggaag cgatgcaccg acgggcgttg      2580
     gaaggatatg aagaggtgct tggacgtgag catcctaaca cgctcaccag tgtcaataac      2640
     cttggctcag ttctctccag gcaagggaaa tacgatgagg cggaagcgat gcaccgacga      2700
     gacctggaag gtagtgagaa ggtgcttggg cgcgagcatc ctgacacgct caccagtgtc      2760
     aataaccttg gcaatgttct ctccagccaa ggcaaatatg acgaggcgga agcgatgcac      2820
     cgacgggcgt tggaaggatg tgaagaggtg cttggacgtg agcatcctaa cacgctcacc      2880
     agtgtcaata accttggctc agttctctcc aggcaaggga aatacgatga ggcggaagcg      2940
     atgcaccgac gagacctgga aggtagtgag aaggtgcttg ggcgcgagca tcctcacacg      3000
     ctcgccagtg tcaataacct tggcaatgtt ctctccagcc aagggaaata tgacgaggcg      3060
     gaagcgatgc accgacgggc gttggaagga tatgaagagg tgcttggacg tgagcatcct      3120
     aacacgctca ccagtgtcaa taaccttggc aatgttctct ccagccaagg gaaatatgac      3180
     gaggcggaag cgatgcaccg acgagacctg gaaggcagtg agaaggtgct tggacgcgag      3240
     catcctgaca cgctcaccag tgttagtaag cttggcaatg ttctctccag ccaaggtaaa      3300
     tatgacgagg cggaagcgat gcaccgacga gacctggaag gtagtgagaa ggtgcttgga      3360
     cgcgagcatc ctgacacgtt caccagtgtc agtaaccttg gcttagttct ctccagccaa      3420
     ggcaaatatg acgaggcgga agcgatgcac cgacgggcgt tggaaggata tgaagaggtg      3480
     cttgggcgcg agcatcctga cacgctcacc agtgtcaata accttggctt agttctctcc      3540
     agccaaggca aatatgacga ggcggaagcg atgcaccgac gagacctgga aggtagtgag      3600
     aaggtgcttg gacgcgagca tcctgacacg ttcaccagtg tcaataacct tggcgatgtt      3660
     ctctccaggc aaggcaaata tgacgaggcg gaagcgatgc accgacgggc gttggaagca      3720
     cgagagaagg tgcttggacg tgagcatcct gacacgctca ccagtgtcag taaccttggc      3780
     ggtgttctct tcagccaagg gaaatatgac gaggcggaag cgatgcatcg acgggcgttg      3840
     gaagcacgag agaatgtgct tggacgggag catcctaaca cgcttaccag tctcagtaac      3900
     cttggcaatg ttctctctag ccaagggaaa tatgacgagg cggaagcgat gcaccgacgg      3960
     gcgttggaag cacgagagaa tgtgcttgga cgtgagcatc ctgacacgct caccagtgtc      4020
     aataaccttg gctatattct ctccagccaa gggaaatatg acgaggcgga agcgatgcac      4080
     cgacgggcgt tggaaggata tgaagaggtg cttggacgtg agcatcctaa cacgctcacc      4140
     agtgtcaata accttggcga tgttctctcc aggcaaggca aatatgacga ggcggaagcg      4200
     atgcaccgac gggcgttgga agcacgagag aaggtgcttg gacgtgagca tcctgacacg      4260
     ctcaccagtg ttagtaacct tggcgatgtt ctctccagcc aagggaaata tgacgaggcg      4320
     gaagcgatgc accgatgggc gttggaagca cgagagaagg tgcttggacg tgagcatcct      4380
     aacacgctca ccagtgtcag taattttggc gatgttctct ccagccaagg taaatatgac      4440
     gaggcggaag cgatgcaccg acgggcgttg gaagcacgag agaaggtgct tggacgtgag      4500
     catcctgaca cgctcaccag tgtcagtaag cttggcaatg ttctctccag ccaaggtaaa      4560
     tatgacgagg cggaagcgat gcaccgacgg gcgttggaag cacgagagaa ggtgcttgga      4620
     cgtgagcatc ctgacacgct caccagtgtt agtaagcttg gcaatgttct ctccagccaa      4680
     ggtaaatatg acgaggcgga agcgatgcac cgacgagacc tggaaggtag tgagaaggtg      4740
     cttggacgcg agcatcctga cacgttcacc agtgtcagta accttgccaa tgttctctcc      4800
     aaccaaggga aatatgacga ggcggaagcg atacacctac aagacatgga aggtagtgag      4860
     aaggtgcttg gacgcgagca tcctgacacg ctcaccagtg tcagtaagct tggcaatgtt      4920
     ctctccaacc aagggaaata tgacgaggcg gaagcgatac acctacaaga catggaaggt      4980
     agtgagaagg tgcttggacg cgagcatcct gacacgctca ccagtgtcag taagcttggc      5040
     aatgttctct ccaaccaagg gaaatatgac gaggcgaaag cgatacacct acaagacatg      5100
     gaaggtagtg agaaggtcct tggatgtgag catcctagaa tactggctag tctcaatatt      5160
     cgttag                                                                 5166
//

If you have problems or comments...

PBIL Back to PBIL home page