(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE220

PENCW_10.PE220       Location/Qualifiers
FT   CDS_pept        complement(503512..504276)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048994" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824872"
FT                   /orf_name="Pc13g02200"
FT                   /product="Pc13g02200 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91289.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018309F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I6"
FT                   /transl_table=1
FT                   /translation="MESPKKLKIASLGSSFAAGPDIPPQIEPRAALRSGQNYPHLLAQH
FT                   LNADLTDLSVSGATLLNITVEPQATPFNVTFPPQSSDLPEDANIITVTAGGNDINYIGG
FT                   MIADACDAELQSSVSLSPSELAERLGGVLDQIHKRAPGARIFLVEYLAVLGPGTQAGRD
FT                   IPLTQERIQYHRGVADVLQHAYSVAVQGRTDWCETVPIHQLSQEHALGSKEPWVGGFES
FT                   GPLLHPNLDGMKAVADILAETIRKSTLSKALL"
     atggaatctc cgaagaaact caaaattgca agtctaggca gctccttcgc tgctggtcct        60
     gacatccccc cacaaatcga accacgtgcc gcattgcgat cagggcagaa ctacccccat       120
     cttctggcgc agcacttgaa tgctgatctc actgatctat ccgtatctgg cgcaacgttg       180
     ctcaacataa cagtcgaacc acaggctacg cccttcaacg tgaccttccc accgcaaagc       240
     tccgacctcc ccgaagatgc caatatcatc accgtgaccg ctggaggaaa cgatataaac       300
     tacattggcg gcatgatcgc cgatgcttgc gatgctgagc tccaatcgtc cgtatcacta       360
     tcaccgagcg aattggcaga acggttaggg ggagttcttg atcagataca caaacgggcc       420
     ccgggagctc gaatcttcct cgttgaatat cttgctgttc tgggacctgg tacccaagct       480
     ggtcgggata tcccgctgac ccaggagaga attcaatatc accgcggtgt tgcggatgtt       540
     ctacaacatg cgtattctgt tgctgtgcaa ggtcgaaccg attggtgcga gacagttcca       600
     attcaccaac tcagccagga acatgcactt ggcagtaaag aaccatgggt tggaggattt       660
     gaatcagggc cgcttctcca tccgaatctc gatggaatga aggccgtagc cgatattcta       720
     gctgagacca tacgcaagag cacattgtcc aaggcattgt tgtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page