(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE221

PENCW_10.PE221       Location/Qualifiers
FT   CDS_pept        505248..505661
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949830"
FT                   /orf_name="Pc13g02210"
FT                   /product="Pc13g02210 protein"
FT                   /protein_id="CAP91290.1"
FT                   /db_xref="UniParc:UPI00018309F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I7"
FT                   /transl_table=1
FT                   /translation="MQISQFLLATGLFASSILAAPITSSDWTILDMKRVCNGENTSCTW
FT                   TFGIDSGLDITDCTFIVEATDASHANGGPSTCGAYTVSSGWSGEFDPTNGFTTLSVANE
FT                   EIGQIIWPAYTDEQLADGDVVKPDQSYPPTAFP"
     atgcagatct ctcagtttct tcttgcaacc ggcctcttcg cctcctccat cttggctgcc        60
     cctatcacca gctccgattg gaccatacta gacatgaagc gtgtctgcaa cggcgaaaac       120
     acctcctgca cctggacctt cggcatcgac tccggtttag acattaccga ctgcaccttt       180
     atcgtggagg ccaccgatgc ctctcacgct aatggaggcc ccagtacatg cggcgcatac       240
     accgtcagct caggctggag cggcgagttt gatcctacca acggcttcac taccttgtct       300
     gttgccaacg aagagatcgg tcagataatc tggcctgcct acaccgacga gcaacttgca       360
     gacggagacg tcgtcaagcc cgaccagagc taccctccca ctgctttccc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page