(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE222

PENCW_10.PE222       Location/Qualifiers
FT   CDS_pept        complement(505971..506774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000084336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949831"
FT                   /orf_name="Pc13g02220"
FT                   /product="Pc13g02220 protein"
FT                   /function="proline racemase activity"
FT                   /protein_id="CAP91291.1"
FT                   /db_xref="GO:0018112"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniParc:UPI00018309F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I8"
FT                   /transl_table=1
FT                   /translation="MESEEYAPMSGSNTICTATVLLETGMVPMKEPITQLTLDTAAGLV
FT                   TVEAKCEGGKCKSVAFDNVPAFVFELDYQVLVPGLGEVSVDIAWGGMMYVLVAAASVGL
FT                   KVESRYSTQLVEIGERIKRAVQATYTPVHPVNPKIKGVSILAFTEPLVEENGCKAAVNT
FT                   VVVSPGRFDRSPCGTGTCARLAVLHARGQLAEGEVFKHRSIIGTEFTSHIRGTTRVGGY
FT                   KAVLPTVAGRAWITSFKQVVLDSSDPFPEGFRVGDQWQMAPSSLL"
     atggaaagcg aagaatacgc acctatgtcg ggatccaaca caatctgcac cgccaccgtg        60
     ctactggaga ccggcatggt cccgatgaaa gagcccatca cccagctgac actggacacc       120
     gccgccggcc tggttaccgt ggaagcaaaa tgcgaaggag ggaaatgcaa gagtgtggca       180
     tttgacaatg tacccgcctt tgtattcgaa ctggactatc aagttttggt tcctggcctt       240
     ggagaagtct ccgttgacat tgcctgggga gggatgatgt acgtgttggt ggctgcagct       300
     tccgtgggtc tgaaagtgga atctcgatat agcacgcagc tagttgagat tggcgagcgt       360
     atcaaacgtg cggtccaagc tacctacacc cctgttcacc cggtgaatcc taaaatcaag       420
     ggagtcagta tcctggcgtt cacggagcct ctcgtagaag agaacggttg caaagctgct       480
     gtcaacaccg ttgttgtctc accagggagg tttgatcgca gtccttgtgg tactggcaca       540
     tgtgctcgac tcgctgttct gcatgcgagg ggtcagctgg cagaagggga ggttttcaaa       600
     catcgcagta ttattggcac cgagtttacc agtcatattc gtggaaccac acgagtcggc       660
     ggatataagg ctgttctccc gactgttgct gggagggctt ggataactag tttcaagcaa       720
     gtagttcttg attcgagtga cccctttcca gaggggttta gggtcgggga tcaatggcaa       780
     atggcaccga gttcattgct ttga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page