(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE224

PENCW_10.PE224       Location/Qualifiers
FT   CDS_pept        join(complement(510290..510925),complement(510042..510241),
FT                   complement(509382..509956),complement(509129..509322))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978065"
FT                   /orf_name="Pc13g02240"
FT                   /product="Pc13g02240 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91293.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001830AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J0"
FT                   /transl_table=1
FT                   /translation="MADEVTAPQQHSSKNKGSEPHPPGQFPSVEEGKQTSANGVLEALG
FT                   YEPELVRNRSTLQVAFMSFVLAAIPYGLATTFTYPLIGGGPVNIIWGWLAVSLITLCVA
FT                   ASLGEITSVYPTAGGVYYQTFMLSPPSYRRIASWICGWSYVVGNITITLAVNLGSTLFF
FT                   VSCINVFESAPGVGIFQATTYQVFLIFLAVTFLANAISAFGNKWLPYLDTFAIFWTLAG
FT                   VLAIVICILAIAKEGRHDAEYVFTSFEPASGWPAGWSFCVGLLQAAYTTSSTGMVICMC
FT                   EEVREPSTQVPKAMVGTVILNTLAGFLFLVPLVFVLPDTKVLAALESGQPVPSIIKSAI
FT                   GSPVGSFLLLLPLILLSLFCVIGCTTAVSRSTWAFARDGGIPGSVWWRQVNRDGVPFNA
FT                   MMLGMTVQILLGFIYFGSTTAFNAFTGVGVITLTVSYVCPIVVSLAGGRRHIKNGQFDL
FT                   GTLGLVCNIVALGWCILVIPLFCMPSSIPVAANTVNYAPVVFVAFILVASGWYWVWGYE
FT                   KYVGPPTMDDEFRSSAW"
     atggcagacg aagtgaccgc cccccagcag cattcttcga agaacaaagg ctccgagccc        60
     catccacctg gacaatttcc cagcgttgaa gaaggcaaac aaacttcagc aaatggtgta       120
     ctggaagccc ttggatatga gcctgaactc gttcgaaacc gctccacgct tcaggtagct       180
     ttcatgtcct tcgtacttgc ggcaattccg tacggactcg ctacgacttt cacctaccct       240
     cttattggag gaggccccgt caacataatt tggggatggc ttgccgtttc tttgattacc       300
     ctttgtgtgg ctgcctcact tggcgagata acctcggttt atccaactgc cggaggggtc       360
     tactaccaaa cctttatgct atctccaccg tcatatcgaa gaatcgcctc gtggatttgc       420
     ggatggtcat acgttgttgg taatatcacc atcacactgg cagtcaacct tgggagtact       480
     cttttcttcg tttcatgtat caacgttttc gaatctgctc caggggtggg gatcttccaa       540
     gcgacaacat accaagtttt tcttatattt cttgcagtca cgtttctcgc taacgcaata       600
     tctgcctttg gtaacaaatg gctaccatat cttgacacct tcgcaatatt ctggacactt       660
     gcaggggtgt tggctattgt aatatgcatt cttgcaattg caaaagaggg tagacatgac       720
     gccgaatatg tctttactag ttttgagcct gcatctggtt ggccagcagg ttggtccttc       780
     tgcgtcggac ttttgcaggc agcttatacc acttcctcca ctggcatggt gatttgtatg       840
     tgcgaagaag ttcgagaacc atcaacacaa gtcccaaaag caatggttgg aacggtcatt       900
     ctaaacacac tggccggatt tctctttctg gttcccctgg tttttgtgct ccccgacaca       960
     aaggttttgg cggccctcga atctggtcaa ccagttccga gtattatcaa atccgctatt      1020
     ggaagtccgg ttggatcatt cctgcttctc ctgccattga tactgctctc tctgttctgc      1080
     gtcataggct gtaccacggc tgtctcccga agcacatggg cgtttgctcg tgatgggggc      1140
     ataccaggct ccgtatggtg gaggcaggta aacagggatg gcgtaccttt caatgctatg      1200
     atgcttggca tgactgttca gatattgctt ggatttattt acttcgggtc aactactgcc      1260
     ttcaatgctt tcacaggagt cggagtcatt accttgactg tcagctatgt ctgtccaatc      1320
     gttgtgtcgc ttgctggagg tcgacgacac ataaagaatg gtcagtttga ccttggcaca      1380
     ctcgggttgg tttgcaacat tgtggcactg ggatggtgta ttcttgtcat tccattattt      1440
     tgcatgcctt cttcaatccc tgttgctgca aatacggtca actacgcacc ggtggtgttt      1500
     gttgcgttta tactagttgc ttctgggtgg tactgggttt gggggtacga gaagtatgtt      1560
     gggccaccaa caatggacga tgagtttcgc tcatcagcct ggtaa                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page