(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE225

PENCW_10.PE225       Location/Qualifiers
FT   CDS_pept        complement(513181..514125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824873"
FT                   /orf_name="Pc13g02250"
FT                   /product="Pc13g02250 protein"
FT                   /protein_id="CAP91294.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J1"
FT                   /transl_table=1
FT                   /translation="MACLVKTMRDPPRESIAQVDGDANTWLIGPLQLHCRKGSSGTFTW
FT                   YDEDDNLSYTLTDAPDPLPPTIPLDDPRFKLVYDAGDSSAVWSVGNSAFCKVKLCRQGV
FT                   TSEAATLKFVQKLVYEQQPDFKIPKVLHQTEHNDRSYLFLTRVQGRTLGDAWPTLDEKW
FT                   RQHYIKAIVNVCKFLESQECDKLCGADGKNALELYLIKYGAEKDYSPDNLRQGCILIGM
FT                   DCSKFVFYHADLGPRNIIVEDIPKTGTVGIIDWELAGYFPRGWIRTKFRISSGLNLPDT
FT                   ATDKPTAWRSGVQELLGEDGFEHYAPEWLSWWD"
     atggcttgcc tagtcaagac tatgcgtgat cctcccaggg agtcaatcgc gcaggtggat        60
     ggggatgcaa acacatggct tattgggccc ctccaactcc attgcagaaa aggctcttct       120
     ggtacattta cctggtatga tgaagacgac aatctcagtt acactctcac cgacgcgcct       180
     gaccccctgc ctccgaccat acccttagat gatccaagat tcaagttggt gtatgatgct       240
     ggggatagct ctgcggtctg gtctgtagga aacagcgctt tttgtaaggt caaactatgc       300
     cgccaaggtg taacttctga agctgcaaca ctgaagttcg tacagaagct cgtctatgag       360
     cagcagcctg atttcaagat ccccaaagtc ttgcaccaaa cagaacacaa tgaccggtct       420
     tacctattcc taaccagagt ccaaggccga acacttgggg atgcttggcc tactctggac       480
     gaaaaatgga gacaacacta cattaaagcc atagtgaatg tttgcaagtt tctcgagagc       540
     caagaatgcg ataaactttg tggagcggat gggaaaaatg ctcttgagct atatcttatc       600
     aaatatggtg cggaaaagga ctattctcct gacaacctcc gacaagggtg tatattgata       660
     ggtatggatt gctcaaaatt tgtgttttac catgccgacc ttggccctag aaatatcatt       720
     gttgaagata tcccgaagac tggcactgtt ggtatcattg attgggagct tgctggctat       780
     ttcccaaggg gatggattcg aaccaagttt cgcataagta gtggactgaa tcttccagat       840
     acagctacgg acaagccaac tgcgtggagg tcgggggttc aagagttgct tggtgaggat       900
     gggttcgaac attatgcacc ggaatggcta tcctggtggg attaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page