(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE226

PENCW_10.PE226       Location/Qualifiers
FT   CDS_pept        join(515497..515601,515684..517471)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949833"
FT                   /orf_name="Pc13g02260"
FT                   /product="Pc13g02260 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91295.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830AC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J2"
FT                   /transl_table=1
FT                   /translation="MENTKELPSPQKKRQNPNRCRPKSRGGCQRCKQRRRRCDEAKPSC
FT                   QECTKRGHTCPGYQKQSLQWRYVFKGSEEAHQPVPPIGSPSTIATESFEVNNSTEQGKD
FT                   NIQDETHNIWDTACPNLFDQLPNFDGPTDAWFYTESTSNGTALGKPDGEVDGLSILRQR
FT                   LAHTSVPSFLIQLPVMLVQYYFHTVCNQWSSFDCPLNPFRTIISRLWSRNAAIYFAIQS
FT                   MSAASLANDFPTMRAIGIQTQQQAIACLNNSVQKGSTQTKDDEYFLALLMIGSTTAWHD
FT                   ASDLGLPYLRAAQDHLLRQERQYKNADSALAKQHPLFKQCLLWWNLLAAFVTEDSPIVD
FT                   VESSIENSETDLAVYLVDGQILPHPWTGSLRYSLSLFYRTARIIRAAKTSHRRRPEALD
FT                   PTLIDLTSMAEELELRQEAENLEDKILFTGFSFYCGPIDIGDSNTPPSHFLTLAEVYRC
FT                   TALLQIYHVFPEILEERLQSNQAADDESPIPALFLVLFPVAAEWSSCSVEDARHTLALH
FT                   IVSLLEQLPSTSGTKVMQPVVLACISSDLVFSSGSVLGAIENAIPSLNTLDVDIAQARR
FT                   KVKMRLSELTIILPKLPMQRIYNVVHETWDRADSGLEEFWLDVMVDLNLETIMG"
     atggaaaaca caaaggaatt gccttccccg cagaagaaaa ggcagaatcc caaccggtgc        60
     cggccaaaat cgagaggggg ctgccaaagg tgcaagcagc ggcgacgcag atgtgatgag       120
     gcaaagccaa gctgtcagga atgcaccaaa cgaggacaca catgccccgg ttaccaaaaa       180
     caaagcttgc agtggcgcta tgttttcaaa ggcagcgaag aggcacatca gccagtccca       240
     ccgattgggt ctcccagcac gatcgcgacc gaatcttttg aagtgaacaa ttcaacagag       300
     cagggaaaag acaatatcca ggatgaaacc cataatatct gggatacggc ctgcccaaac       360
     ctctttgacc agctaccaaa ttttgacggg ccaacagatg cctggtttta caccgagtcg       420
     acttctaacg gtacggctct aggcaagcct gatggcgagg tggacgggtt gtcgattttg       480
     cgtcaacgac tggcccatac atccgtcccc tcctttctaa tccaactgcc agtgatgctg       540
     gtgcaatatt actttcatac ggtttgtaac caatggtcat ctttcgactg cccccttaat       600
     cctttccgaa ccattattag ccgtctctgg agtcgaaatg cggcgattta ctttgctatc       660
     cagagcatgt cggctgcctc gttggccaac gattttccaa ccatgagagc catcggaata       720
     cagacacaac agcaagcaat cgcgtgtctg aataacagtg tccaaaaggg ttccactcag       780
     acaaaggatg atgagtactt tctggcacta ctcatgattg gatcgaccac tgcgtggcac       840
     gatgcttcgg atttggggct tccatatctg agagcagccc aagaccatct tctgagacaa       900
     gaacgccagt acaagaatgc cgactctgcc ctcgcaaaac aacatccact tttcaaacag       960
     tgtctccttt ggtggaactt attagctgcc tttgtgacag aggactcccc aattgtggac      1020
     gtggaaagct ctatagaaaa cagcgaaaca gatcttgcag tctatcttgt cgatggacag      1080
     atcctacccc atccgtggac agggtccctc agatactcat tgagtctctt ctatcgaacg      1140
     gcaagaataa ttagagctgc aaaaacctcc caccgccgaa ggccagaggc tttggatccc      1200
     acattgattg atcttacctc catggccgaa gaactcgagc tcagacagga agccgaaaat      1260
     ctcgaggaca agattctctt cactgggttc tcgttttatt gcggccctat cgacattggg      1320
     gattcaaaca cgccaccatc acattttctt acgttggccg aggtatatcg atgtacggca      1380
     ctgttgcaaa tttatcatgt cttcccggaa atcctggaag aacggcttca aagtaaccaa      1440
     gccgcggatg acgaaagccc tataccggcc ctatttctgg tgttgttccc agtggccgcc      1500
     gaatggtcat cgtgttcggt ggaagacgca cgacacactc tagcactgca tattgtgtcc      1560
     ctcttggagc aacttccttc aacatctgga acgaaggtta tgcagcccgt ggttttggca      1620
     tgcatctcta gcgatcttgt tttctcgtct gggtctgtgc tgggcgccat cgaaaatgcg      1680
     attcccagtc tgaatacact ggatgttgac attgcccagg ccagacgaaa ggtcaaaatg      1740
     cggttgtctg aacttaccat aatcctacca aagctgccaa tgcaacgcat ttataacgtt      1800
     gtacatgaga cgtgggatcg cgcggactct gggttagagg agttctggct ggatgttatg      1860
     gtggacttga atttggaaac aattatggga tag                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page