(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE227

PENCW_10.PE227       Location/Qualifiers
FT   CDS_pept        join(complement(519177..519236),complement(519051..519129),
FT                   complement(518782..518998),complement(518495..518735),
FT                   complement(518284..518445),complement(518074..518232))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129230"
FT                   /orf_name="Pc13g02270"
FT                   /product="Pc13g02270 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91296.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001830AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J3"
FT                   /transl_table=1
FT                   /translation="MGVSNMNQMEFQDTPAAKHPVWKRWVRFRAEDGKIYGGEPVNPDI
FT                   DVGQAIEKDVEVSVKVVTGNSALDYDAPFTGEIKTIDELLSPVSQAEAGTVRCVGLNYK
FT                   EHAAEMKLTLPNTPTVFLKASTCIASASEPIILPSNVDYDEADYEVELAIIIGRQCKNV
FT                   SVSKAGDYVLGYAVANDVTARKHQEKTSQWSYAKGMDGFCPLGPCIVSTEQIPDAARLN
FT                   LKTRLNGKIMQNGSADDMIFSIPEIVSYVSQGHTLLPGTVIITGTPCGIGISQSPPQFL
FT                   QPGDELRISISHGLGTQICPIARA"
     atgggagtgt cgaacatgaa tcaaatggag ttccaagaca ccccggcagc aaaacatcca        60
     gtttggaagc gatgggtccg tttcagagcg gaagatggta aaatatatgg cggggagccg       120
     gtgaatccag atattgatgt gggtcaggcc atagagaagg atgttgaagt atcagtcaaa       180
     gtcgtgactg gtaactcggc attggattat gatgctccat tcacgggtga aatcaaaacc       240
     attgacgaac tgctatctcc agtctcgcaa gccgaagctg ggactgttcg gtgcgtcggc       300
     ctaaactata aggagcacgc ggccgagatg aagttgacac tgccaaacac gccgactgta       360
     tttctaaagg cgagcacttg cattgcatct gcatccgaac cgattatact tccctccaac       420
     gtggattatg atgaagcaga ctatgaagtt gagttggcga ttatcatcgg cagacaatgc       480
     aagaacgtct cggtgtccaa agctggggac tatgttctgg gatatgcagt cgccaatgac       540
     gtgacagccc gcaagcatca agagaagaca tcacagtggt cttatgcaaa gggaatggat       600
     ggattttgcc cactcggtcc atgtatcgtg tctacagaac aaatccccga tgctgcacgt       660
     ttgaatttaa agacccgtct caatggaaag atcatgcaga atggatccgc cgatgacatg       720
     atcttcagca taccggaaat tgtctcttat gtttctcagg gccacacatt actgcctggg       780
     accgtcatca tcaccggaac gccttgtggt attggcatct cacagagccc gccacagttc       840
     ctccaacccg gagatgagct gcggataagc ataagccatg ggttaggcac tcaaatatgc       900
     ccgattgcga gagcttga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page