(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE229

PENCW_10.PE229       Location/Qualifiers
FT   CDS_pept        join(complement(523667..523892),complement(521850..523609))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949835"
FT                   /orf_name="Pc13g02290"
FT                   /product="Pc13g02290 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91298.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830ACB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H0"
FT                   /transl_table=1
FT                   /translation="MSTNEGKRNKLALDPRPRARRGRKTTSCSQCHARKQKCNRELPCS
FT                   RCIQRGIPQLCQWAEKEKGHAMPPERVRTAADTQGTELGQLYIARGAPSFFGNSYFGHQ
FT                   VAARMIQESAPDLPPMSLLSSKDSLQSFRNDSGPFSQVWDLLGLLPRNKVTVDRLIEKF
FT                   LTEINWAIDTVHPETFRSQFAEFWGRKFGFDEIAGVDLRWLALLFIILAFSVLLDSPTI
FT                   SSPEKRKESEEASLRFYWAARRAIVISPSFHGESLDLVRAGLMVTRYLLYTRQVAESWL
FT                   TISFAMRMAQAQGMHIDGEKWGLSRKATEIRRRLWSNLYLLDKTIALALGRPYAISDHM
FT                   CLIKAPDNIWLDGLTDEESSTATAHALSYPTMSTVTLLGSGLGKIAGEIQDRCFGLYPA
FT                   SYDMVIEMDNKLVAWKEKLPSYFSVEDPDLSLDGSHTFLPWHRLYLHSAFHFARITLHR
FT                   PYLLRESITNRFSLSHEACISSASSDLKIRLQSLNYGTSENMRWTLGTHNMFNSAFILG
FT                   IIAVRRPIAPQTTAILNDLEEYCERLRKDVWLNEFGLAEVKVVELCILRTTGLARATEQ
FT                   PGEQTSMSPPEVLPGFMAQERERNSMMSTPMNIESIVADGSPSHPPGSSPDIMWPAVWE
FT                   DQNFAFPQAADLETWEQMISEIAYHT"
     atgagtacca atgaaggaaa gagaaacaag ctggcactcg acccccgccc tagagcaaga        60
     cggggaagaa aaacaacttc ctgttctcaa tgtcacgcca ggaagcagaa atgtaacaga       120
     gaactgcctt gctctcgttg tattcagcgt gggattcctc aactatgtca atgggcggaa       180
     aaagagaagg gtcatgcaat gccaccagaa agagtgagga cagcagcaga cacccagggc       240
     acagagctgg ggcagttgta tattgcccgg ggagcaccta gcttcttcgg taattcatac       300
     tttggccacc aggtggcagc ccgtatgatt caggagtcag ctcccgatct gccccctatg       360
     agcctgctgt ctagcaagga ttctttgcaa tcgtttcgaa acgactctgg gccattttcg       420
     caagtttggg atttacttgg cctcttaccg cggaataaag tgaccgttga tcggctaatc       480
     gagaaatttc tgaccgagat caactgggct atcgatacgg ttcaccctga aaccttcaga       540
     tctcaatttg cagagttctg gggccgaaaa tttggattcg acgagattgc tggagtagat       600
     cttcgctggc ttgctctttt gtttatcatt ctcgctttta gcgtgctatt ggacagtcct       660
     acgatctctt cgcccgaaaa gcggaaagaa agcgaagaag cttctcttcg gttctactgg       720
     gctgccagga gggcgatcgt tatctcaccc tcttttcacg gcgagagctt agaccttgtc       780
     agagcagggc tgatggttac gcgatatctg ctatacacca gacaagtcgc agagagctgg       840
     ctcaccatca gctttgccat gcgcatggcc caagcacaag gcatgcacat agatggagaa       900
     aaatggggat tatcgagaaa agccactgaa atcagaagac gcctttggag caatctgtac       960
     ttgcttgaca aaaccattgc cctcgccctc ggcagaccat acgcgatttc agatcacatg      1020
     tgtctcatca aagcacctga taacatatgg ctggatggat tgactgatga agagtcctct      1080
     actgcgacag cccatgcatt gagctatcct acaatgagca cagtcacact gctcggtagt      1140
     gggctaggta aaattgcagg tgaaattcaa gaccgatgct ttggtttata tcctgcgtcg      1200
     tacgatatgg tgatcgagat ggacaacaaa cttgtcgcat ggaaagaaaa actcccatcc      1260
     tacttttccg tggaagaccc cgacctctca ctggatgggt cgcatacatt tctaccttgg      1320
     catcgcctct atctacattc tgctttccac tttgccagaa tcactctgca ccgaccttat      1380
     cttctacgcg agtctataac caatcgtttc agccttagtc acgaggcatg tatatcctct      1440
     gcatcttccg acctgaaaat cagattgcag tccttgaact atggaacgtc agaaaatatg      1500
     agatggacac tgggtaccca caatatgttc aacagtgcct tcatcctggg cattatcgca      1560
     gtgcggcgac ccattgcccc tcagactacc gcaatcttga acgatctcga ggaatactgt      1620
     gaaaggttac gcaaggatgt ttggctaaat gagtttggtc ttgccgaggt caaagtggta      1680
     gagttatgta tactccgtac cactggactt gcccgggcca ccgagcaacc aggtgagcag      1740
     acctcaatga gtccacctga agtattgcca ggttttatgg cacaagagcg cgaaaggaat      1800
     tcaatgatgt cgacgcccat gaacatcgag tctattgtgg cggatggctc gcccagccac      1860
     ccacctggtt cgtcgcccga tataatgtgg cctgcagtct gggaagatca gaactttgcg      1920
     tttccgcagg ctgctgatct ggaaacatgg gagcaaatga tctccgaaat tgcatatcac      1980
     acttag                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page