(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE231

PENCW_10.PE231       Location/Qualifiers
FT   CDS_pept        join(complement(533442..533452),complement(533368..533385),
FT                   complement(527899..533301),complement(527539..527833))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949836"
FT                   /orf_name="Pc13g02310"
FT                   /product="Pc13g02310 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAP91300.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="UniParc:UPI0001830ACD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H2"
FT                   /transl_table=1
FT                   /translation="MASRLDRLVTLLETGSTQLIRNTAAQQLADVQKQHPDELFNLLGR
FT                   ILPYLRSKSWDTRTASAKAIGLIVSNADIHDPNEDDGLQIKSAAEEDDVEIKSEIKSEE
FT                   PIPADDFLKLDTLDIPSVLKYGKRLLGSAGKEYEYSLASMEPASRLQHQKKTLTSRLGL
FT                   EGEYLEEDLIEDIELAPKVVTPAPKHEPTIPPIPHHSSLHEASSRRPSSPSESATKEDG
FT                   GLSKRQLNQLKRKNKQNAKMGANKVRVVDLSSRRQSDIVTTPLATTPHPVKAENGDDHN
FT                   GETKPDYFSFERTEEDDDSKLVTEFKGAVAPERPHILPDIVEQGAGWPLEHMCEFLTMD
FT                   IFDSNWEVRHGAAMALREVIRVQGAAAGRLDGKSRSENDALNRRWLDDLSCRLLCVLML
FT                   DRFGDYISDNVVAPIRETVGQTLGALLSHLHPNSVRAAYRCLYRIIMQTDLGLDRPVWE
FT                   VCHGGMIGLRYLVAVRKDLLVKDSNMMDGVLEAVMKGLADYDDDVRAVSAATLVPIAEE
FT                   FVSSRTGTLGPLMNIVWDCLSNLQDDLSASTGSVMDLLAKLCTFSQVLDAMKANAADDP
FT                   EASFGKLVPRLYPFLRHTITSVRSAVLRALMTFLKLEGEGTTDWVDGKALRLIFQNLLV
FT                   ERNEGVLKLSGQVWSELLNVVEMRGSFKSEDELSGSIQPLITLTLGAFGVPRYPIPMNT
FT                   SLFIKPSGLPFSAALPAPTPSKGSPPASIPGGAETKVGRRRKSEKKEKEPPPPSAHNVD
FT                   GHMLSGDIDLVGADTMLRSKIYAAKALGALISFWDKNELSSLWPAILDGLNASASTTQL
FT                   ASAMVLEEYARQSGPESKYRSSLCDRLRPILEGERPSWYSDIACYLHVARSQCHSLLNT
FT                   FRDHAHVAPSRLPTLAVVVQGDSEAGPNAFSLADAEKIVGPDFDRLKKNLTPAQRITAT
FT                   QVLNDTRTTAQSAVEEARLMREQRDMRVLAATAGALVALRDIPKKPGHIIKGMMDSVKK
FT                   EENVELQQRSATAVAGLIEHYTAATKRGPVDKIIGNLVKYCCVDTSETPEFPHNVQLEK
FT                   SILSLRKEEDRRDHPDAAKFEREAREARIMRRGAKDALEQLAVKFGPELLEKVPNLAKL
FT                   VERPLRDALAGDELPEDITNPENELGQEIVDGLSTLRALLPKFDPGLHEWVIDLMPIIA
FT                   KGLQCRLSVIRYAAAKCFATICSVITVKGMTMLVEKVLPLINNGLDVNHRQGAIECIYH
FT                   LIHVMEDGILPYVIFLVVPVLGRMSDSDNDVRLLATTSFATLVKLVPLEAGIPDPPGFS
FT                   AELLEGRDRERKFMSQMLDVRKVEPFEIPVAIKAELRPYQQDGVNWLAFLNRYNLHGIL
FT                   CDDMGLGKTLQTICIVASDHHMRAEEFAKSQSTDSRKLPSLIVCPPSLSGHWQQEVKQY
FT                   APFLSCIAYVGPPAERTRLQPLLATTDVIVTSYDVCRNDNDILSPINFNYCVLDEGHLI
FT                   KNPKAKITSSVKKLASNHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFLDRFAKP
FT                   IAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPKIIQNYYCDPSEL
FT                   QKKLFEDFTKKEQKELADKVGSADRGDKEHIFQALQYMRRLCNSPALVVKEGHKQYNEV
FT                   QSFLSAKRSNIRDVSHAPKLNALKDLLVDCGIGLDHTAEGELDTGASYVSPHRALVFCQ
FT                   MKEMLDIVQNDVLKKLLPSVQYLRLDGGVEATKRQDIVNRFNTDPSYDVLLLTTSVGGL
FT                   GLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRLITRGTLEEKILNLQRF
FT                   KIDVASTVVNQQNAGLGTMDTDQLLDLFNLGETADTAEKPSDTAGYEVDMVDIDGEVKE
FT                   KGKKGWLDDLGELWDDRQYQEEYNLDSFLETMKN"
     atggcttccc gactcgaccg tctcgtcaca ctactcgaga cgggcagtac tcagttgatt        60
     cgtaatactg ctgctcagca gcttgcagat gtgcagaaac agcatccaga tgagctgttc       120
     aatctactcg gacgcatctt gccgtacctc agatccaagt cctgggacac aaggacagct       180
     tctgccaaag ctattggact gattgtctct aacgccgaca tccatgatcc aaatgaggac       240
     gatggactcc agatcaagtc tgcagcagag gaagatgatg tggagattaa gtccgagatc       300
     aaatccgaag agccgattcc ggccgatgat ttcctcaaac tcgacaccct ggacatccct       360
     tccgtattaa aatatggaaa gcggctgctc ggcagtgcgg gcaaggagta cgagtactcc       420
     ctcgcgtcca tggagccagc ttcccgtctg cagcaccaaa agaagacttt gacttcaagg       480
     ctgggcctcg aaggcgaata cctcgaagaa gacctgatcg aggatatcga attggctcct       540
     aaagtggtaa ctcctgcccc aaagcatgag cctactatcc cgccgattcc tcatcatagc       600
     agtcttcatg aagcttcctc ccgccggccc tcctcgccta gtgaaagtgc gacaaaggaa       660
     gacggagggc tgagcaagcg acagctcaat cagctcaaac ggaaaaacaa acagaacgct       720
     aagatggggg ccaacaaagt ccgtgtcgtg gacctgtctt ctcgtcgaca gtccgatatt       780
     gtcacaaccc ctctggccac aactcctcat cctgtcaaag cagagaatgg agatgaccac       840
     aacggcgaga caaaacctga ttacttttcc tttgaacgca ctgaagaaga tgacgattct       900
     aagcttgtta ctgaattcaa aggagctgtc gccccagagc gacctcatat cctgccagat       960
     attgtggagc agggtgcagg atggcctctg gaacacatgt gtgaattctt gactatggac      1020
     atcttcgact ccaactggga agttcggcat ggcgcggcaa tggccctgcg tgaagtaatc      1080
     agggtccagg gcgcggcagc tggccgcctg gatggaaaat ctcgctcaga aaacgatgca      1140
     ctcaatcgcc ggtggctgga tgacctctca tgtcgactac tctgtgtttt gatgcttgac      1200
     cgatttggtg actacatttc agacaatgtg gttgcgccga ttcgcgaaac cgtgggccag      1260
     actctcggtg ctcttctctc acacctacac ccgaactcag ttcgagcggc ctaccgatgc      1320
     ctataccgga tcataatgca gaccgacctg ggactggacc gtcccgtatg ggaggtctgc      1380
     catggtggta tgatcgggct gcggtacctt gtcgcagttc gaaaggactt gctcgtcaag      1440
     gattctaaca tgatggatgg cgtactggaa gctgtcatga aaggcctcgc tgattatgat      1500
     gatgatgtcc gcgctgttag cgccgccaca cttgttccca ttgcagagga gtttgtgtcc      1560
     tcccggactg gcactcttgg ccctctaatg aacatcgtct gggactgtct ctccaatcta      1620
     caggatgatc ttagtgctag tacaggctct gtgatggacc ttttggccaa gctgtgcaca      1680
     ttctcccaag ttctggatgc tatgaaggct aacgctgcag atgatccgga agcgtccttt      1740
     ggaaaacttg ttcctcgcct ctacccattc ctccgccata ctatcaccag cgttcgctcg      1800
     gctgtcctcc gggctcttat gacattcttg aagctggagg gcgagggcac tacagattgg      1860
     gtagatggca aggcattgcg cttgatcttc caaaatcttc tcgtggagcg caacgagggt      1920
     gttttgaagc tgtctggcca agtgtggtct gaactactta atgttgttga gatgcgcggt      1980
     tcattcaagt ccgaagacga gttatcaggc tccatccagc cgcttatcac tctgactctg      2040
     ggtgctttcg gcgttccccg gtaccccatc cccatgaaca cctcactctt tatcaaaccg      2100
     tctggtctgc cattctccgc cgctctcccg gctcccacgc cttccaaagg ctctccccct      2160
     gcttctattc cgggcggcgc tgagaccaag gtgggacgga ggcgcaaatc ggagaagaaa      2220
     gagaaagagc cacctccgcc gtcagctcac aacgtggacg gacatatgct ttccggtgat      2280
     attgacctcg ttggtgcaga taccatgctg agatccaaga tctacgccgc caaggcgttg      2340
     ggcgcactga tatctttctg ggacaagaat gaattatcta gcctttggcc ggcaattctg      2400
     gatggcctta atgcttctgc ttccacaacc cagcttgcct cggccatggt cctggaagag      2460
     tatgctcgcc aatccggacc agagagcaaa tatcgctcgt ctttgtgtga ccgtcttcga      2520
     ccaattctcg aaggcgagcg cccatcctgg tattccgaca ttgcgtgcta ccttcatgtc      2580
     gcgcgctccc agtgccattc attactgaat accttccggg atcatgcgca tgtggcacct      2640
     tcccggctgc caaccttggc tgtggtcgtt cagggcgact cagaagctgg gcctaatgca      2700
     ttttctttgg cggacgccga gaaaatcgtt ggtcctgatt ttgatcggct gaagaaaaat      2760
     ctcacaccgg cccaacggat cactgctacc caagtcttaa atgacactcg taccactgcc      2820
     caatccgccg tggaggaggc gcgattgatg agggaacagc gggacatgcg tgttcttgct      2880
     gccactgctg gtgccctggt cgcgttgcgg gatatcccca agaagcctgg ccacatcatc      2940
     aagggcatga tggacagtgt caagaaggag gagaatgtag aacttcagca gcgctctgcg      3000
     acagcagtgg caggccttat cgaacactac acagccgcca cgaagcgtgg accagtggac      3060
     aagatcattg gtaacttggt taaatactgc tgtgtggaca catccgagac acccgaattc      3120
     ccgcacaacg tgcagttgga gaagtcaatc ttgtcgctac gcaaagaaga agaccgacgc      3180
     gaccatccag atgcggccaa attcgaaaga gaggcaagag aggcacggat tatgcgtcgt      3240
     ggtgctaagg atgcgctgga gcaactggca gtcaagttcg gccctgagct gttggagaag      3300
     gttcccaatc tcgcgaagtt ggtcgaacgg ccattgaggg atgctttggc aggagatgaa      3360
     cttcccgagg atatcaccaa cccagagaat gaacttggtc aagaaattgt ggatggtctg      3420
     tctacactgc gggctctgct acccaagttt gatccaggtc tccacgaatg ggtcatcgac      3480
     cttatgccga ttatcgccaa gggtttgcag tgccgacttt ctgtcattcg ttacgcagca      3540
     gccaaatgtt tcgctacaat ttgcagtgtc atcaccgtca agggcatgac aatgctggtt      3600
     gaaaaggtct tgccacttat taacaatggg ttggatgtca atcaccgtca aggtgcgatt      3660
     gagtgcatct atcatttgat ccatgttatg gaagatggga ttcttcccta cgtcatcttc      3720
     ctggtggttc ctgtccttgg ccgaatgagc gactccgaca acgatgtgcg tctcctagcg      3780
     acaacatcat tcgccaccct cgtcaaactc gttcctctgg aggccggtat tcccgatcct      3840
     cctggcttct cagcagagtt gctggaaggc cgtgaccgag agaggaagtt catgtcccag      3900
     atgctggatg tgcgcaaggt tgagccgttc gaaattccag tcgcgatcaa ggccgagctc      3960
     cgaccttatc agcaggacgg tgtcaactgg cttgctttcc tcaaccgcta caatctgcat      4020
     ggtattcttt gcgacgacat gggccttggc aagacactgc agaccatctg catcgtggcg      4080
     agtgaccacc atatgcgagc ggaagagttc gccaagagtc aatctacaga ctctcgaaaa      4140
     ttgccttctt tgattgtctg tccaccttct ctctccggac attggcagca ggaagtcaag      4200
     cagtatgctc ctttcctcag ttgcattgca tatgtcgggc ctcccgcgga acggacgaga      4260
     ctccaaccct tgctggccac cacagatgtc attgtaactt cctacgatgt ttgccgcaat      4320
     gacaacgata tcctctctcc tatcaacttc aactactgcg tgctggacga gggccatctt      4380
     atcaagaacc ccaaggccaa gatcacgtct tcagttaaga agttagccag caaccaccgt      4440
     ctgatcctct ctggcactcc aatccagaac aacgtccttg aactgtggtc gctcttcgac      4500
     ttcttgatgc ccggtttctt gggaacagag aaagtcttct tggatcggtt cgccaagcca      4560
     attgcagcga gccgtttcag caaatcctct tccaaggaac aagaggcagg tgctttagca      4620
     atcgaggcac tgcacaaaca ggtcctgcca ttcctcctcc gtcgtctaaa agaggaagtc      4680
     ttgaatgatc tccctcccaa gattatccag aactactact gcgacccgag tgaactgcag      4740
     aagaaactgt tcgaggactt caccaagaag gagcagaagg agttggcaga taaggtgggc      4800
     agcgcagacc gaggcgacaa agagcatatc ttccaggcgc ttcaatacat gcgacgtcta      4860
     tgtaactctc ctgccttggt tgtcaaggaa ggtcacaagc agtacaacga ggtgcaaagc      4920
     ttcctgagtg ccaagcgttc gaacatcaga gatgtttccc acgcgcccaa gctaaacgcc      4980
     ctgaaagatt tgctggtgga ttgcggtatt ggcctggacc acacagcaga gggtgaactg      5040
     gatacaggcg caagctatgt cagcccccac cgagcccttg tgttctgtca gatgaaggag      5100
     atgctggaca ttgtgcagaa cgatgtcctc aagaaactcc tcccgtccgt gcaatacctt      5160
     cgcctggatg gaggcgtgga agcaaccaag cgccaggaca tcgttaaccg attcaacacc      5220
     gacccaagtt acgacgtctt actcctgact actagtgttg gtggattggg tctcaacctt      5280
     acgggtgcag acaccgtcat tttcgtggag cacgactgga acccacagaa agatatccag      5340
     gctatggacc gtgcccatcg tatcggtcaa aagaaggttg tcaacgtgta ccgcttgatc      5400
     acgcgaggta ccctggagga gaagatcctg aacttgcaac gattcaagat cgacgtcgcc      5460
     tccactgtcg tcaatcaaca gaacgccggg ctcggaacaa tggacacaga ccaactgctc      5520
     gacctgttca atctcggcga aacagcagac acagccgaga agccaagtga cacagccggc      5580
     tatgaagtcg acatggttga tatcgacggc gaagtcaagg agaagggcaa gaagggttgg      5640
     ctagacgatt tgggcgagct ctgggatgac cgccagtacc aggaagaata caacctggat      5700
     tcgttcctgg agaccatgaa aaattga                                          5727
//

If you have problems or comments...

PBIL Back to PBIL home page