(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE232

PENCW_10.PE232       Location/Qualifiers
FT   CDS_pept        join(complement(534984..535199),complement(534758..534900),
FT                   complement(534420..534468),complement(534213..534278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978067"
FT                   /orf_name="Pc13g02320"
FT                   /product="Pc13g02320 protein"
FT                   /protein_id="CAP91301.1"
FT                   /db_xref="UniParc:UPI0001830ACE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H4"
FT                   /transl_table=1
FT                   /translation="MASDHNLRTQFPPPRIKPANAVWLFLGPGRCYPFWQEVLGCYVVN
FT                   SGDGASGKKKCVPALDDYYECLHHRKEALRTMKMQAAYRKAEAAHPRENAPKAEQIRSL
FT                   GLLGKEEDAANVLSQREIGLLASPTRLAAYPGENNAQGKGEGNGIEDENLYTP"
     atggcgtcgg atcacaactt gcgcacccag ttcccgcccc cgcgtataaa accggctaac        60
     gcagtatggc tttttctagg tcccggccgc tgctacccct tctggcaaga agttcttggt       120
     tgctacgtgg tgaactcagg cgatggtgcg agcggcaaga agaagtgtgt gcccgccctg       180
     gatgactact atgagtgcct tcaccaccgg aaagaggctc tccgcactat gaagatgcaa       240
     gctgcctatc gcaaggccga ggcggcacac ccccgagaaa acgcccccaa ggctgagcaa       300
     atccggagct tgggtctact cgggaaggaa gaggatgcag ccaatgtgct gagccaacgg       360
     gaaataggtc tccttgccag tcccacgcgc ctagccgctt atcccgggga aaataatgca       420
     caagggaagg gggaggggaa tgggattgaa gatgagaatc tgtatactcc gtag             474
//

If you have problems or comments...

PBIL Back to PBIL home page