(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE233

PENCW_10.PE233       Location/Qualifiers
FT   CDS_pept        join(535472..536999,537051..537207,537261..538362)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210383" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672166"
FT                   /orf_name="Pc13g02330"
FT                   /product="Pc13g02330 protein"
FT                   /protein_id="CAP91302.1"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniParc:UPI0001830B76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H5"
FT                   /transl_table=1
FT                   /translation="MALEELSDAHAILLATHLCASGSVADLPILQARFPHCFPLERLLR
FT                   IILTFLPESTEPSQYTTVLQELANSSNLPSDRPIDTSAVQDLSESLARKRVRKIHLRPL
FT                   QRPDEEDEIASADPLTKFLIHRAHLIDSETALQPLILDLIIPFYEHSPVIRTWLISSLL
FT                   PLLRLNYEFYAHRDETISLEILESMDDQTAVNILLSLMSSEENSMDLVNNLRGLIGPWL
FT                   YGGNRSKRRRLNEAAQQSSVSFIEGSEKPQATELAGWEHVNEWLLSRSLVDRDSVVGAF
FT                   TRWDGPSDVDLGGYDNGGTQLSEEQAKDLQVRYGQSGLAVVYAHADSSMAVLEGSFQVL
FT                   TRVAKLLDLEDSSYLTPDSELPSVHYDTESMSSTSRASLLQNSLLRPTNPLTKPSPPSV
FT                   SFLSALLLSLRILTELGHLVPCRVAANMCLHSTEEMQLAELKSVVDSTVKQPNLNQDWS
FT                   MVRQRLLWLRDWQAEQFDNAWDEPSPYHGLFWRIPRDTVEIEILKALLAAKEYELAIDI
FT                   YTNSKSAPLEPAQVEAAVQEAIFTAYDNASNGNRTRGGMKRAYDILQSFTPHFPDSVVF
FT                   KQIHALIAATHALSYYSLTLQHGVPFQPVSIRVHHDPILLIEKVLEQNAKSYTKLDDLL
FT                   SIGRNLVAADVPTQAASNEAEDEPTHHKPSKEHALLTAERRITSLAIASALSSNDFGTA
FT                   YSYILTRLTPPSLLSTSSPLLNTTSVPDDITWRAVYNAGRHRATTPTHPPPTLQSQISH
FT                   LSQRMELLSLSLVLVPSPDPLPEILGAWRRCDEELTSLRAREQQEEDLWDRKGDTLSSV
FT                   PGGFGPSDSERDAFDTERQRAARRARAAMPNSHHHEAPMGLFEVARGAALALHKNAFPL
FT                   RGAADGSAPLAPRDGDRPLSPDSEGHVRKRDMVSNMMTGGLVSGIGWVLGADPVNKK"
     atggctctcg aagagctgtc cgacgcgcat gctattctac tagctacaca cctctgtgca        60
     agtggtagtg tggcggacct gcctattcta caggcccggt ttccccattg ttttccgtta       120
     gaacgcctcc tgcgcatcat cttgaccttt ctcccagaga gcacagagcc ctctcagtac       180
     accacagtgc tacaagagct agcaaatagc tctaacctgc catccgaccg accgatcgat       240
     acctctgccg tccaggactt gtccgaatcg ctcgcaagga agcgcgtgcg gaagattcat       300
     ttacggccac tgcaacgtcc tgatgaggaa gacgagatag cttcagcaga tcctttgacc       360
     aaattcctta tccaccgggc gcatttgatc gactcggaaa cagcactaca gcctctcatt       420
     ctcgatctta tcatcccgtt ctacgagcac tcaccagtca ttcgaacatg gctgatatca       480
     agcttattac cattgcttcg acttaactac gagttctacg cccatcgcga cgaaactata       540
     tctcttgaga tccttgagtc tatggacgat caaaccgcgg tcaacattct cctgtctttg       600
     atgagctccg aagagaacag catggacttg gtcaacaacc tgaggggtct gattggacct       660
     tggctttatg gcggtaatcg gtcaaaacgg cggaggctta acgaagcagc tcagcagagt       720
     tcggtatctt tcattgaagg ctccgagaaa cctcaagcaa ccgaattggc tggatgggaa       780
     catgtgaatg aatggctact gtcgcggagt cttgtcgacc gtgacagcgt tgttggcgca       840
     ttcacccgtt gggatggacc atcagatgtg gatttggggg gatacgacaa tggtggcacg       900
     caattgtccg aagagcaggc gaaagattta caggttcgat acggccagtc aggtcttgct       960
     gtcgtgtatg cccatgccga ctcatcaatg gctgtgctgg agggctcgtt ccaggtattg      1020
     acaagggtcg cgaagctcct tgatcttgaa gacagctcgt acctcacacc tgactcagaa      1080
     ttgccatctg tgcactatga taccgagtca atgtcctcga catcccgtgc atctctattg      1140
     cagaactctc ttttaagacc gacgaaccct cttaccaaac cgtcaccccc gtcggtctcg      1200
     tttctcagcg ctttacttct ctccctccgt atactgaccg aacttggtca tctcgtccct      1260
     tgccgggttg cggcaaatat gtgccttcac agcaccgagg aaatgcaact ggccgaactc      1320
     aaaagcgtgg tggattctac tgtgaagcaa ccgaatttaa accaagactg gtctatggtt      1380
     cgacaacgat tgctttggct tcgggattgg caggcggaac agttcgacaa cgcctgggat      1440
     gaaccttcac cataccatgg acttttctgg cggatcccgc gcgacaccgt tgagatagag      1500
     atcttgaagg cgctgctggc agctaaagag tatgaattgg ctattgatat atacaccaac      1560
     tccaaatcag cgccactcga acctgcccaa gtggaagctg cggtccaaga ggccatattc      1620
     acagcgtatg ataatgcaag caacggaaat cgaacccgcg gcggaatgaa gagagcttat      1680
     gatatcttac aatcattcac accacacttc ccagactctg ttgtattcaa acagattcac      1740
     gccctcatcg ccgcaacaca cgcactctca tactattcgc tgaccctgca gcacggcgtt      1800
     ccattccagc ctgtcagcat tcgtgtccat cacgatccca tccttctgat tgagaaagta      1860
     ctcgagcaaa acgcaaagag ctacaccaaa ctagacgatc ttctctctat cggacgaaac      1920
     ctagtggccg cagacgtacc cacgcaggcg gcatcaaacg aagccgaaga cgagccaact      1980
     caccataaac cctcaaagga gcacgcgctc ctcactgcag aacgccgcat cacctctcta      2040
     gcaatcgcct ccgctctatc gtccaacgac ttcggcacag cctactccta catcctaacc      2100
     cgactcacac ccccgtctct cctctcaacc tcctcccccc tcttaaacac cacctccgta      2160
     cccgacgaca tcacctggcg tgccgtctac aacgcgggtc gtcaccgcgc cacaacacca      2220
     acccaccccc ctccaaccct ccaatcccaa atctcgcacc tctcccagcg aatggaactc      2280
     ctctccctct ctctcgtcct cgtcccatcc ccagacccgc tcccagagat cctcggcgcc      2340
     tggcgtcgct gcgacgaaga gctcacatcg ctgcgcgcac gcgagcagca agaagaagac      2400
     ctctgggaca gaaaaggcga cacattgtcc tccgtcccgg gcggattcgg gccctcggac      2460
     tcagagcgtg atgcctttga tacggagcgg cagcgtgcgg ctcgccgtgc gcgcgctgca      2520
     atgccgaact ctcatcacca cgaggcgccc atgggtctat ttgaggttgc tcgtggcgct      2580
     gctttggcgc tgcataagaa tgctttcccg ctgaggggcg cagctgatgg ttcggcgccg      2640
     cttgctcctc gcgacggtga tcggccgctg tcgccagata gtgagggtca tgttaggaag      2700
     agggatatgg ttagcaatat gatgactggg ggcttggtta gtgggattgg ttgggttctt      2760
     ggcgccgatc cggtgaataa gaagtag                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page