(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE237

PENCW_10.PE237       Location/Qualifiers
FT   CDS_pept        join(551074..551257,551342..552503,552556..552808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210360" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949838"
FT                   /orf_name="Pc13g02370"
FT                   /product="Pc13g02370 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91306.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI0001830B7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H9"
FT                   /transl_table=1
FT                   /translation="MDIDSQGPQNNGVNGTEERSPTPPPHQPNSASADEADSFKLAGNK
FT                   FFKDGNYRRAIEEYNKAIEINPNSSAYLSNRAAAYMSAKQFLNALEDVQRSNELDPNNP
FT                   KIMHRWAKILTSLGRPEEALEVLSRIQPPATATDRAAAEKMLRFVTQAEQTIAEDRGLS
FT                   MVIYCLDQARQGLGQGVKEPRKWTLLAAEAHLRLDNVNSLGKAQDIAISLLRENSQDPD
FT                   AMMIRARAFYALGESEQAQKLLKMCLGLDPDMKQAIKLLRIVQKLARTKEEGNNAFKAK
FT                   DYHRAIELWAQALEVDPSNKDMNAKILGNRAQAYINLKEYDSAIEDCTEALRLDSGYIK
FT                   AMKCRAKAHGKAGNWEEAVRDYKSVAENNPNEPGIAEEIHEAEFELKKSQRKDYYKILG
FT                   VGKDASDQEIKKAYRKLAILYHPDKNRDGAAGDEKFKEIGEAYETLIDSQKRAAYDNGD
FT                   ELREGMPGGMHGGMHGFGGINPDILRDMMNGGGGFGGASFGGASFGGGGFGGGGFGGHS
FT                   HGGNPFGGPGAGFSF"
     atggatattg attcccaggg acctcagaat aatggcgtga atggcactga ggagcgaagt        60
     ccgaccccgc caccgcacca gccgaactca gcctctgccg acgaggccga ctccttcaag       120
     ctggccggaa acaagttttt caaggatggc aactaccgac gagccatcga ggaatacaac       180
     aaggccatcg agatcaatcc gaactcatcg gcctatctct ctaaccgagc ggccgcttat       240
     atgtccgcta aacaattttt gaatgcgctt gaggatgttc agcgctccaa cgagctcgat       300
     cctaacaacc caaagatcat gcaccgatgg gcgaagattc tgacgagttt gggtcgaccc       360
     gaagaggccc tggaggtgct gtcacgcatc cagccaccgg cgaccgccac tgaccgggca       420
     gccgcagaga agatgctgcg cttcgttaca caagccgaac agacaatagc agaagaccgc       480
     ggtctctcga tggtgatcta ttgtctcgac caggcacgac aagggctcgg acaaggtgtc       540
     aaggagcccc gcaagtggac acttttggcc gctgaggccc atctgagact ggataacgtc       600
     aactccctag gcaaggcgca ggatattgcg atcagcttgc tgcgcgagaa cagccaagac       660
     ccggatgcga tgatgatccg tgcccgtgcc ttctatgccc tcggtgagtc cgagcaggcg       720
     cagaagctcc tgaagatgtg cctcgggctg gacccagaca tgaagcaggc cattaagctg       780
     ctacgcattg tgcagaaatt ggctcgcaca aaggaagaag gaaacaacgc tttcaaggcc       840
     aaggattatc accgtgctat cgaactttgg gcccaggctc tcgaagttga tccctccaac       900
     aaggatatga atgccaagat tctgggtaac cgtgctcagg cttatatcaa cctgaaggag       960
     tatgattctg ccattgagga ctgcactgaa gctctccgtc ttgactccgg atatatcaag      1020
     gctatgaagt gccgtgccaa ggcccacggc aaggccggta actgggagga ggctgttcgt      1080
     gattataaga gcgttgctga gaacaacccc aacgagcctg gcattgcgga ggagatccac      1140
     gaagctgaat tcgagctgaa gaagtcccag cgcaaagact actataagat tttgggagtc      1200
     ggcaaggatg ccagcgatca agaaatcaag aaggcctacc gcaagctcgc cattctatac      1260
     cacccagaca agaaccgcga cggtgcagcc ggcgatgaaa agttcaagga aatcggtgaa      1320
     gcctatgaga ccttgattga ttctcagaaa cgtgctgctt atgataacgg tgacgaattg      1380
     agggagggca tgcctggcgg catgcatggc ggtatgcatg ggttcggcgg tatcaatccc      1440
     gatattctcc gagacatgat gaacggcgga ggtggcttcg gaggtgcctc gttcggtggt      1500
     gcttcgttcg gcggcggtgg cttcggcggc ggtggctttg gtggccattc tcacggcggc      1560
     aaccccttcg gtggtcccgg agccggcttt tcgttctag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page