(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE238

PENCW_10.PE238       Location/Qualifiers
FT   CDS_pept        complement(553935..556187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129233"
FT                   /orf_name="Pc13g02380"
FT                   /product="Pc13g02380 protein"
FT                   /protein_id="CAP91307.1"
FT                   /db_xref="UniParc:UPI0001830B7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G7"
FT                   /transl_table=1
FT                   /translation="MDDGPPPPPPPHGENPHTTQGEYRKSSDLPDGNYDIFIVPPHSAG
FT                   SGFLYLPSLQCNRNSFLAGVASTLVACFVWSYISPIVKAWYLATVASGSGTGMAVLAIG
FT                   VGVAGWLFGSIQSTSSGDNKGNGGARGGRFGFGGFGGGSGGPGDPGGPGGPRNAGPNTN
FT                   QYSSGANYGGNGAGQQRQQGGNFGGGQPHGNQYSGNQHGSGTPPNSDNNKREKEEAEKR
FT                   AKEERAKEERAREQRAKEERAREERAREERAREERVREERAKQERAREERAREERAREE
FT                   RIKEERAREERAKERAKEEAERERAREETRRKEELRRKMEEFKRKRDAEAKEKEKKRER
FT                   EAMEKELQERREQLEREMAAARAAAEKEARERLEREAAEARERQAKAEAEAKAKLEKLE
FT                   AEAKEKAAKEAAEKEAAAKAAAQKEAMAKFAALKEAASKKYAEKKAQDAKKEAAAKSPP
FT                   PKPASTSNVPRTPSPKKPAPYSTAKTANEDDAYSFRPYDRPRRPYAAGSVYSESSYTPS
FT                   NSTARTTPPPSHRSTYSTKDPDKIVIQGVYAFNNAFMKTPVAQLVSGQGMITDGLVLRI
FT                   TTEGLFIDDDLRGIGQREWDVKAWTLKLAEVWCPQVNAASSAKTASSNPFSFRRGNNVP
FT                   TNEESEAFLGNLLKVCKNTCRLASPSACFARSATASHDGGPVHPPQAEFRGLHILRASV
FT                   RDQEGKKYVFVLQDTEAWKVAIGLQRLRGGALVRALGVSALPVPECKTMLSALGYV"
     atggacgacg gtccgccacc gccgccgcca cctcacggcg aaaatcccca tacgactcaa        60
     ggcgaatatc gcaaatcctc ggacctgccg gatgggaact acgacatctt tatcgtccca       120
     cctcactctg ctggctcggg tttcctttac ctgccgtccc tgcagtgcaa ccgaaacagt       180
     ttcctagcag gtgtcgcaag cacactcgtc gcatgtttcg tgtggtcgta catctccccg       240
     attgtgaaag catggtatct agccacggtc gctagcggca gtggtacggg tatggcggta       300
     ctggcgatcg gggtgggtgt ggctggatgg ctttttggct ccattcagtc caccagctca       360
     ggagacaata aaggcaatgg cggcgctcga ggtggacgat tcggatttgg cggctttggt       420
     ggtggttctg ggggcccagg cgaccctgga ggcccgggtg gccctaggaa cgccggtccc       480
     aacaccaatc aatattcgtc gggtgcgaat tatggcggga acggggcagg tcagcaaagg       540
     cagcagggag gaaattttgg tggaggacaa cctcacggca accaatattc cggtaatcaa       600
     catggctctg gtactcctcc aaactctgat aataacaaac gtgaaaagga ggaggcagaa       660
     aagcgcgcta aagaagagcg agccaaggag gagcgagcta gggagcaacg tgctaaggaa       720
     gaacgtgctc gtgaagagcg tgctagggag gaacgtgcta gagaggagcg cgttagagaa       780
     gaacgagcta agcaagagcg tgctagagag gagcgagcta gagaggagcg agccagagaa       840
     gagcgcatca aggaggagcg ggctagagag gaacgggcca aggaacgggc taaggaagaa       900
     gccgaacggg agcgagcaag agaagaaacg agacgcaaag aggagctacg ccgaaagatg       960
     gaggagttca agcgcaagcg tgatgcagag gccaaagaaa aagagaaaaa gcgcgagcgc      1020
     gaagcaatgg aaaaggaatt acaggaacgg cgcgagcaac tcgaaaggga gatggccgct      1080
     gcgagggccg ctgcagagaa ggaggcacgc gagcgactgg agagggaagc cgcagaggcc      1140
     cgcgagagac aagcaaaggc cgaagctgag gcaaaggcca agctcgaaaa gttggaggca      1200
     gaagccaaag agaaggccgc caaagaagct gccgagaaag aagctgccgc aaaggccgct      1260
     gcccaaaaag aagccatggc caaatttgcg gcgctcaagg aagcagcaag caagaaatac      1320
     gccgagaaga aggcgcaaga cgcaaagaaa gaggccgctg ccaaatcacc gccgcccaag      1380
     ccagctagta ctagcaatgt gcctcgtacc ccttctccca agaaaccagc gccctactca      1440
     accgccaaaa ccgccaacga agacgatgct tattcctttc gcccctatga ccgaccacga      1500
     cgcccatatg cggctggctc ggtgtactcc gagtcttcat atacaccttc gaactctact      1560
     gcgcgcacaa cacctccccc ctcacatcgc agtacatatt ctaccaagga tccagataag      1620
     atcgtgatcc aaggtgtata cgccttcaac aacgccttta tgaagacccc agtggcgcaa      1680
     cttgtctcag gccaaggcat gatcaccgat gggttagtgc tgcgcatcac aacggaaggc      1740
     ctcttcatcg acgacgacct acgcggcatc ggccagcgcg agtgggacgt caaggcctgg      1800
     acccttaagc tagcggaggt gtggtgccca caggtaaacg ccgcttcatc cgccaaaact      1860
     gcgtccagca accccttctc tttccgtcgt gggaacaatg ttcccactaa cgaagaatca      1920
     gaggcctttc tcggtaactt gcttaaagta tgcaagaata cttgccgcct agcttcgccc      1980
     agtgcatgct tcgctcgcag cgctactgcc agccatgatg gtggccctgt tcacccgcct      2040
     caggcggagt tccgtgggtt gcacattctc cgcgccagtg ttcgtgacca agaaggcaag      2100
     aagtatgtct ttgtgctgca ggatactgag gcctggaagg tcgctatcgg tctccagcgc      2160
     ctccggggtg gtgctctggt ccgcgcgctg ggtgtgtctg ctctgccggt ccctgaatgc      2220
     aaaactatgc tcagtgctct cggttatgtt tga                                   2253
//

If you have problems or comments...

PBIL Back to PBIL home page