(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE239

PENCW_10.PE239       Location/Qualifiers
FT   CDS_pept        join(558256..559147,559209..559306,559360..561405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210316" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949839"
FT                   /orf_name="Pc13g02390"
FT                   /product="Pc13g02390 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91308.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001830B7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G8"
FT                   /transl_table=1
FT                   /translation="MSSQSHHGHSATPRQFPVYNPVAAVAAPAGTLLPGTKIQVGSHRV
FT                   VVEKYLSEGGFAHVYVVRLPQPVNGSETAVLKRVAVPDKAALANMRTEVETMKKLKGHR
FT                   HIVKYIDSHASQLRGGGYEVFLVMEYCAGGGLIDFMNTRLQHRLTEPEIVKIFSDVAEG
FT                   VACMHYLKPPLLHRDLKVENVLISGKGSSATYKLCDFGSSAPPRPAATSAAEGRLIEDD
FT                   VQRHTTLQYRSPEMIDVYRKQPIDEKSDIWALGVFLYKLCYYTTPFEEVGQMAILNATF
FT                   KYPSYPSFSSRLKLLIGSMLKEDPRNRPNIYEVVREVCKMQGKEVPIKDIYSNRSVSEA
FT                   RKYQELPPTPTEAPAVGAVFSPPMQETEIIPEIAPMRRGRPGKSSSSQPSSERPSPSPY
FT                   RPAAEGSSSDPFAALDGSAARKKTAEEMSKRFPSLDQFDILHEKGDKFEFEPTVESKPE
FT                   DEDLSRRLTNALADDAFARRVSPERAPKPVYKRPSQNSPVRAPNLRETPAPQSVPLYQP
FT                   TPQRPTMVSTGTMTSPIQTPRLPDPKLLSRPIYRFPSSDAEHRSFSEPFTTEKEQRVTR
FT                   PHKAPSPPMSSLNVEESSRLPSDRISSQSNSARPSMETLRRPPTLEVNEPVGRSKSAIG
FT                   KARPMSVQAGVRYDPPYDSESPRSSLDMSRLQYEGGAPLRSVRTDVDRESDRTISSDVD
FT                   YLRAMEEEESNRKREKRSSGSHKHNKRGSLSTLSLSGGKNLFAGRFGDAFRRFEAGNPE
FT                   KSSSPSVEDAPRQGLIGTSDSADEGLSPNDEITLEDADRDDISPEMRRELERRRLSQEE
FT                   KRVANAAAEYRRRVAETGDGGGRTTGDGARSRTIQNKVQSLLGESEKPTVPKTATGYGR
FT                   FTETSSSLQAKQSEARPTSSSQLPASHTSGPTYAARDGSMALPDRRELPQSAAPTPYPS
FT                   TQRPAARPAAPPKPKNLRAGTATSRPGTGHDHGPSQETQTPASPGDDWEAKFSQRFPSL
FT                   SGLEMETEIKIPKISSLRTREV"
     atgtcctctc aatctcacca cggtcattcc gcgacgccac gtcaattccc cgtctacaat        60
     cccgtcgccg cagtggcagc acctgcgggg accttgcttc cgggcaccaa gattcaagtc       120
     ggcagccatc gcgtggtagt ggagaagtac ctctccgaag gcggttttgc tcatgtctac       180
     gtggtgcgat tgcctcagcc agtcaatggg tccgaaaccg cagtgctgaa gcgggtggcc       240
     gtgcctgaca aggcggccct tgctaacatg cgcactgagg tggaaaccat gaagaaactc       300
     aagggtcacc ggcacattgt gaagtatatt gactcgcatg cctcgcagct gcgtggaggt       360
     ggatatgaag tgtttctggt catggagtac tgcgcaggtg gtggtcttat cgacttcatg       420
     aacacccggc ttcaacaccg gttgacagag ccggagatcg tcaagatctt ctccgatgtt       480
     gctgagggtg ttgcctgcat gcactatctt aaaccgcccc tgctccaccg agatctgaaa       540
     gttgagaacg ttttgatctc gggtaagggg agttccgcca cctataaact atgtgatttt       600
     ggatcatcgg caccccctcg tcctgctgcc acttccgccg ccgaggggcg cttgattgaa       660
     gacgacgtgc agcggcatac gacgttgcag tatcgaagcc cagagatgat tgatgtctat       720
     cggaagcaac cgattgacga aaaaagcgat atctgggcac ttggtgtgtt tttgtacaaa       780
     ttatgctatt atacaacccc cttcgaagag gtcggtcaga tggctattct caacgcgacc       840
     ttcaaatatc cttcctaccc ttcgttttcg agtcggctaa agctgctcat tggctcaatg       900
     ttgaaggaag atccccgcaa tcgtcccaat atatacgagg ttgtgcgcga ggtgtgcaaa       960
     atgcaaggaa aggaagttcc tatcaaagat atctattcca accgctctgt ttcggaagcg      1020
     cgcaagtatc aagagctgcc gcccacgccc acggaagctc ctgccgtggg cgcagtattt      1080
     tcgcctccaa tgcaggagac cgagataatc ccagagattg cgcctatgcg gcgtggtcga      1140
     cctgggaaat cctcctcgtc ccaacctagc tccgagagac cgagtccctc gccctaccga      1200
     cccgctgctg aaggctcgtc aagtgatcct tttgcagccc tggatggcag tgcagcccgg      1260
     aagaagacgg cagaggaaat gtcaaaacgg ttcccctcct tggaccagtt tgacattttg      1320
     catgaaaaag gggacaagtt cgaattcgag ccaacagtag aatctaagcc cgaggacgag      1380
     gatctatctc gaagactcac caacgcccta gccgatgatg cttttgcccg acgtgtctcg      1440
     cctgaacgtg cgccgaagcc agtctataag cggccatccc agaattctcc tgtccgagca      1500
     cctaatttgc gtgaaactcc cgcgccgcag tctgttccct tgtaccagcc aacccctcag      1560
     cggcccacga tggtgtcgac aggtaccatg acctcgccca tccaaacacc tcgtttgccg      1620
     gacccaaagc tgttgagccg tccaatctat cgattccctt cgtctgatgc tgaacaccga      1680
     tctttcagcg agccatttac aactgagaag gaacagagag tgacacggcc gcataaggcg      1740
     ccatcccctc ctatgtcgag cttgaatgtg gaagaaagct cgcggctgcc ttctgaccgt      1800
     atatccagcc aatctaactc tgcgcgcccc tcgatggaaa ccttgagacg gcctccgaca      1860
     ttagaggtaa acgaacccgt ggggcgttcc aaatccgcca ttggaaaggc tcgcccgatg      1920
     tcagtccagg cgggagtgag atatgacccg ccgtatgact ctgagagccc gcggtcgtcg      1980
     ctggatatgt ctcgcctgca atacgaggga ggcgcgccgc tacggtcagt gcgtaccgat      2040
     gtggatcgtg agtctgatcg aactatttcc tctgatgtcg attacctacg cgcgatggaa      2100
     gaagaagaaa gcaaccggaa gcgagagaaa cgctctagtg gtagccacaa acacaacaag      2160
     cgcggtagtc tgtctacttt gtcgctttct ggaggcaaga acctgtttgc tggtcgattt      2220
     ggcgacgcat tccgccgatt cgaggcgggc aatccagaga agtcctcgtc gccatccgta      2280
     gaggatgcac cccgccaggg tctgattgga acgtcggatt cagccgacga aggcctttcg      2340
     ccaaatgacg agattacgtt ggaagacgcg gaccgggacg atatatcacc ggagatgcgc      2400
     cgggagcttg aacgccgccg gctctcgcaa gaggaaaaac gggttgccaa tgccgcagct      2460
     gagtaccggc gccgggttgc cgaaacaggc gacgggggtg gaagaacgac cggggatggc      2520
     gcacgctccc gcacgattca aaataaggta caatcgttgc ttggagagtc tgaaaaaccg      2580
     accgttccta aaactgctac tggatatgga cggttcacgg agacttcctc ttctttgcag      2640
     gcaaagcaga gtgaggccag acccaccagc tccagccagc ttcccgcttc tcacacatcc      2700
     ggcccgacgt acgctgctcg tgacggttca atggcactcc cggatcgtcg agagctcccg      2760
     caatctgccg ctcctacccc ttacccatcc acgcaacgtc ccgcagctcg accagctgca      2820
     ccacccaagc ccaagaattt gcgtgctgga acagctacct cgcgaccggg tactggtcat      2880
     gaccatggtc cctcccaaga gacccagacc ccagcaagcc cgggcgatga ctgggaggcc      2940
     aaattcagcc agcgttttcc aagtttgtcc ggacttgaga tggagacaga gatcaaaatc      3000
     ccgaaaatct ctagcctgag gacgcgggaa gtgtaa                                3036
//

If you have problems or comments...

PBIL Back to PBIL home page