(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE240

PENCW_10.PE240       Location/Qualifiers
FT   CDS_pept        join(561742..561772,561826..561922,562060..562450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978068"
FT                   /orf_name="Pc13g02400"
FT                   /product="Pc13g02400 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP91309.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniParc:UPI0001830B7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G9"
FT                   /transl_table=1
FT                   /translation="MAPVTLKTVDDDLKDVIQHLFEIQSAVHGYLGPETQQELVRKIKN
FT                   LTLALSTLSTHTQLPPTQENQPDANTDPSNPSLASIQLPPEIIDYVDSARNPDIYTREF
FT                   VELVQRGNQDLRGKREAFASFRDVLAREMRSAMPECRGEVDRVVAATSGAVDGPDGATE
FT                   AAATSGGLN"
     atggcgccag tgactttgaa aacggtcgat gacgacctca aagatgtgat ccagcactta        60
     ttcgagatcc aatccgccgt ccacggctat ctgggtccgg agactcagca ggagcttgtg       120
     cgaaagatca aaaacctaac cctcgccctg tcgaccctgt caacacacac ccaactcccg       180
     ccgacacaag agaaccaacc agacgcaaac accgacccct ccaacccctc cctcgccagc       240
     atccagctcc cgccagagat aattgactac gtcgactccg cgcgcaaccc ggacatctac       300
     acgcgagagt tcgtcgagct tgtgcagcgt ggtaatcagg acctgcgcgg gaagcgcgag       360
     gcctttgcga gcttccgcga cgtgctggcc cgcgagatgc gcagcgctat gcccgagtgc       420
     cgcggcgagg ttgatcgtgt agttgccgcg acaagtgggg cggttgatgg tcccgatggt       480
     gccaccgaag ctgcggctac atctggtggt ctgaattga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page