(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE241

PENCW_10.PE241       Location/Qualifiers
FT   CDS_pept        join(563010..563112,563221..563267,563326..563745,
FT                   563780..564296,564356..564743,564793..565402)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949840"
FT                   /orf_name="Pc13g02410"
FT                   /product="Pc13g02410 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91310.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR012531"
FT                   /db_xref="UniParc:UPI0001830B7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H3"
FT                   /transl_table=1
FT                   /translation="MKQISEDEFPDLMKYNASSKDPIGGSVFALSPEKAKSIDCQLGVV
FT                   QSKPRPTNHRIAELEQENEILRQKCAQLRSSNTISAGRVQSEPDHSVTSESTPRTPLPF
FT                   SRVTGIGLSWNDSPSTSTRDASHPEVPENDRRNTSLYHGPTSTVYDDTSPNHDEQNRPG
FT                   QSNEEGTRHFLFSQTARQSKLDLMQYEQLEPLNLAAGKLDFDGIDPEIGMHLLSIYWSR
FT                   QLYTAQIIYRPAFMRDMACEGPYFSKLLLNAIFFVVSKHCDRPELRSDPNDITTAGWKF
FT                   RQRFTQLLRDSFDKSEMTTLQALLIMSNALFSRCDERSLSWLYAGNAFNMFIDLGLHVL
FT                   PAVDSITAEELEIRKRVLWGAYLIDKIQCLFQGRPPLLNRVNLRASLDFLDDYDELEPF
FT                   QGITYMNTKPGVIPSLNVSLLTNLCELTTIVERILREIYSESRESNLIHRDRANISEEI
FT                   KSQLRTWRQNLPLRLDYLSFPDQAVFLPQSACLLALFNVLIILVHRPLIIGHDRVINST
FT                   TAHESVNACTAAANQIVQILHDYSQHFSLSSAPYMLSYATYISATIHARIVAQKGSNSS
FT                   MFQSLVLCRNILAEHTRLYSAAEKAKENLDKLISHLGISAADDNLRTGSPGSSGSNFPN
FT                   EHMVMDESINVAREPGVADGAVEFGSSLMSLELSDLDLEAIAQGFQVDVESHSFWNSLV
FT                   "
     atgaagcaaa tctcggaaga tgagtttccg gacctcatga agtacaatgc cagctcgaag        60
     gacccgatcg gcggcagcgt gtttgcattg tcgccagaaa aagccaagag tatcgattgt       120
     cagctaggcg tggtccagag taagccaagg ccgaccaacc accgtattgc ggaattagag       180
     caggagaatg aaatccttcg acagaaatgt gcccagctcc ggagcagcaa caccatttcc       240
     gctggaaggg tccaatcaga gccggatcat tctgttacat cggaaagcac tccacgtact       300
     ccattgccat tctcgagagt aacgggcatt ggtctctcgt ggaatgactc tccctccact       360
     tcaactagag atgcatcaca cccagaagta ccggagaacg accgcagaaa cacgtcattg       420
     tatcatggcc caacgagtac agtgtatgat gatactagtc cgaaccacga tgaacagaat       480
     agaccaggtc aatccaacga agagggaacg cggcattttc tcttttccca gacagcgagg       540
     cagagcaagt tggatctcat gcaatacgaa cagcttgagc cactcaatct tgccgccgga       600
     aaactcgact ttgatggcat cgatcctgag atcggtatgc atttactctc catatactgg       660
     agtcgtcagc tttacacagc acagataatt taccggccgg ctttcatgcg agatatggcc       720
     tgcgagggac catacttttc caaattgctg ttgaatgcga tctttttcgt ggtatcgaag       780
     cattgcgacc gaccagagct tcgttcagac ccaaatgaca ttacgactgc agggtggaag       840
     ttccggcaac gcttcacgca gcttttgcga gattccttcg ataaaagcga aatgactacc       900
     cttcaggcat tgttgattat gtctaatgcg cttttttcca gatgtgacga acggagtctg       960
     tcatggctat acgctggaaa tgcattcaac atgttcattg atcttggtct gcatgtgctt      1020
     cctgctgtgg atagtatcac tgccgaggaa cttgaaattc gaaagcgagt tctctgggga      1080
     gcatacttaa ttgataagat tcaatgtctt ttccaaggga gacctcctct tctcaaccgt      1140
     gtcaacttga gagcgtcact agacttcctg gatgactatg atgagctcga accttttcag      1200
     ggtatcacct acatgaatac aaagcctgga gtgattccat cactgaatgt ttctttgctc      1260
     accaatttat gcgaactgac aacaattgtg gaacgtattc ttcgtgaaat ttattcggaa      1320
     tctcgagagt caaatttgat ccatagggat agggcaaata tctcggagga aatcaagtcg      1380
     cagctgagaa cctggcgcca aaatttgccg cttcggcttg actatctgtc attcccagat      1440
     caggcggtct tcctgcctca gtccgcctgt cttttagctt tgttcaacgt gcttatcatt      1500
     ttggtccacc gtcctctgat aattggtcac gacagggtca tcaattcaac aactgcccat      1560
     gagtcagtga acgcatgtac agcagctgcg aaccaaattg ttcagattct ccatgactat      1620
     tcgcagcact tttctctgag cagcgcaccg tacatgctgt cttacgctac ctatatcagt      1680
     gcaacaatcc acgcacggat tgttgcacag aaagggagta actcaagcat gtttcaatca      1740
     ctggttcttt gccgaaatat tcttgcggaa catacacgcc tttattctgc agcagagaag      1800
     gctaaggaaa atttggataa gttgatttct cacttaggga tcagtgctgc agacgacaat      1860
     ctacgcactg gaagccccgg gagttctggg agcaacttcc ccaacgagca catggtcatg      1920
     gatgagtcga ttaatgttgc cagggaaccc ggcgtcgcag atggtgcagt tgaatttgga      1980
     tcttccctga tgagtttgga attatcggat ctagatcttg aggcaattgc tcaaggcttt      2040
     caggttgatg tagagtcgca ttcgttctgg aattctttgg tatga                      2085
//

If you have problems or comments...

PBIL Back to PBIL home page