(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE242

PENCW_10.PE242       Location/Qualifiers
FT   CDS_pept        join(complement(566283..566436),complement(566141..566233),
FT                   complement(565507..566072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978069"
FT                   /orf_name="Pc13g02420"
FT                   /product="Pc13g02420 protein"
FT                   /function="carbon-carbon lyase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="CAP91311.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016830"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI0001830B7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J5"
FT                   /transl_table=1
FT                   /translation="MQGLNRVKTVLDKGGLALGVWQLLPGSNMSRTLARAGYDWVLVDC
FT                   EHGNIDDAAMHEAVPAITSYGVSPIVRVPDFQSWMIKRALDAGAHGVLAPLVRTVEDTK
FT                   AFVEACRFPPQGKRGFGSPFPMDRFGRDVSATQYLTEANANLLLSVQIETKEAFDNVDS
FT                   IAAVEGLDLLFVGPFDLGNGIGHPVLGSTFAPELEQAIERILSSAHKAGKKAGIYCGNG
FT                   KQAKKYADLGYDFVNVVTDVGALTSSLASEMEIVTQKAGRTASGPYGS"
     atgcaaggtc taaatcgtgt aaagacagtg ctcgacaagg gcggcctcgc tctgggagtg        60
     tggcagttac tgcccggcag caacatgtct cgcactctag caagagctgg atacgattgg       120
     gttttagtgg actgtgaaca cggaaatatt gatgatgccg caatgcacga agctgtcccc       180
     gccataacgt catatggagt gagcccgatt gtccgcgtgc cagatttcca atcttggatg       240
     attaaacgtg ccctggacgc aggcgcacac ggagttctcg ctcctctcgt gcgaacagtg       300
     gaagacacaa aggccttcgt cgaggcttgt cgattcccac ctcaagggaa gcgaggcttc       360
     ggatcgcctt ttccaatgga caggtttggc agggatgtat cagccaccca gtatctgact       420
     gaggccaatg ccaatctcct gctctcagtt cagattgaga cgaaagaggc ttttgacaat       480
     gttgattcta tcgccgccgt cgaaggactc gatttgttat ttgtcggacc ttttgacctg       540
     ggcaatggta ttgggcaccc cgtgttgggt agcacttttg cgcctgaatt agaacaagcc       600
     atcgagagaa ttctgtcttc ggcgcacaag gcaggcaaga aggctgggat ctactgtgga       660
     aatggaaagc aggcaaagaa atatgccgac ctagggtatg actttgtcaa cgttgtgact       720
     gatgttggtg ctctgactag ctcgctcgcg agtgagatgg agattgtcac ccagaaagca       780
     ggcaggactg cctctgggcc ttacggtagc tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page