(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE244

PENCW_10.PE244       Location/Qualifiers
FT   CDS_pept        complement(569181..570518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949841"
FT                   /orf_name="Pc13g02440"
FT                   /product="Pc13g02440 protein"
FT                   /biological_process="response to antibiotic"
FT                   /protein_id="CAP91313.1"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniParc:UPI0001830B81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J7"
FT                   /transl_table=1
FT                   /translation="MPQLQELFNSAVQPLPAIEDKGFASHFDTFAGSRVILLGDGSHGT
FT                   SEFYSARAEITKRLIERHGYTMVAVEADWPDAEAIDRYVRLRPGPKAQIGGKAKQYEPF
FT                   NRFPTWMWRNAEMQQLVEWMRDRNQALPPEQRAGFYGLDLYSMGASIRAVIEYLEKVDR
FT                   PTAKQARQRYGCLEPWVDEPTSYGLASLRGMEDCEAPVIKMLGELLEKRLEYASSHDGD
FT                   EYHSGEQNAHLVRDAEKYYKSMYYSSASSWNLRDTHMFDTLERLLKHNEGEKAIVWAHN
FT                   SHVGDARYTSMGYRRNEINIGQLCRERLGGDNVTILGCGTHTGTVAAAHEWDDDMEVMS
FT                   VRPSRDDSWEIVAHDTGVPSFVLELRKDRIDPALRAAMAAEQRLERFIGVIYRPDTERV
FT                   SHYSQAFLHKQLDGYIWFDRTQAVKPLEVIQPETPLGKGETYPFGL"
     atgcctcaac tacaggaact gttcaattca gcagtgcagc ccctgcctgc aatcgaggac        60
     aagggcttcg catcacactt cgataccttt gcgggtagcc gagtgattct cctaggcgat       120
     ggcagccatg ggacatctga gttctattct gcacgcgcag agatcacaaa gcgactcatt       180
     gaacgacatg gctataccat ggtcgcggtt gaagcagact ggccggatgc agaggccatc       240
     gaccgatacg tgcgcttgcg cccaggtccc aaggcgcaaa ttggaggaaa agcgaaacaa       300
     tatgaaccat tcaatcgatt ccctacctgg atgtggagga atgccgagat gcaacagcta       360
     gttgaatgga tgcgtgatcg aaaccaggcc ctcccaccag agcaaagagc cgggttctac       420
     gggctggacc tgtacagcat gggagcctcg attcgtgctg tgattgaata cttggagaag       480
     gttgaccgac cgacagccaa gcaagcgcgc cagcgatatg ggtgtctaga gccttgggtt       540
     gatgaaccca cttcatatgg tctggcatcc cttcgaggca tggaagactg tgaagccccg       600
     gtgattaaga tgctcggaga acttctggag aaacggcttg aatatgccag ctcgcatgat       660
     ggcgatgaat accacagcgg cgaacagaat gcgcacctgg ttcgggacgc ggagaagtat       720
     tacaagtcaa tgtactacag ctcagcgagt tcgtggaacc tgcgcgacac gcacatgttt       780
     gacaccttgg aacgcctgct aaagcacaat gagggagaga aagctattgt gtgggcgcac       840
     aattcccacg tcggggatgc gcgctataca agcatgggct atcgccgcaa tgagatcaac       900
     atcgggcagc tatgccgtga acgactggga ggcgataatg tgaccattct tggatgcgga       960
     actcacaccg gcactgtcgc ggcggcccat gagtgggacg atgatatgga ggtcatgtcc      1020
     gtccgtccat cccgagatga tagctgggaa attgttgccc atgatacagg ggtgcccagc      1080
     ttcgtgctcg aattgcgtaa ggaccgcata gatcccgctc tgcgcgcagc tatggctgct      1140
     gagcaacggc tggagcgttt cattggtgtc atctaccgcc ctgataccga gcgtgtctcc      1200
     cactactcgc aggctttcct tcacaagcag cttgatggtt atatctggtt cgataggacc      1260
     caggctgtca aacctttgga ggtcatccaa cccgagacgc cgcttggaaa gggcgaaact      1320
     tatccattcg gactctag                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page