(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE245

PENCW_10.PE245       Location/Qualifiers
FT   CDS_pept        join(<570959..571793,571862..572229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129235"
FT                   /orf_name="Pc13g02450"
FT                   /product="Pc13g02450 protein"
FT                   /protein_id="CAP91314.1"
FT                   /db_xref="UniParc:UPI0001830C38"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J8"
FT                   /transl_table=1
FT                   /translation="LPVSSPSPRLDRCGQAMESLYGSFSNIEDPNTWTPPPRSGGHRGR
FT                   YLWTDAFGVVNFLTMHQEYKRTGNDTTGDDRYLVLAGRLIETVHDVLGKTRDGRSRLRG
FT                   ATDENPLSGGLRIGKTDARGPDGDGQYHHYLTVWMFALNRMAKASGDLKYNRQAIELAK
FT                   AIHPRFFVDRAAARPRMIWKMSMDLSEPLVKSEGNLDPIDGFVVFRLLQDTAMEAGDGA
FT                   FLAEEIDDYRRTMERKGEHFVSSDPLDLGMTLWTAHWFSGRERWAADLAGKCFEQIYNL
FT                   FEINQYLERNIKFRLAFREFGTCMGIQCQSEVKEKERTVDLKCYSDAIIAAWDPYMQLS
FT                   ISDDLTPADLRPITRVMYASALIPGGKLSQTILYDESGILTHFPIPAFQAGFLGPEPTP
FT                   T"
     ctcccagtca gcagtccgtc accgcggcta gaccgctgtg gacaagctat ggaatctctt        60
     tacgggagtt ttagcaacat cgaagaccca aacacctgga ctccaccacc gagatcaggc       120
     ggtcatcggg ggcggtacct atggacagac gccttcgggg ttgtcaactt tctcacaatg       180
     caccaggagt ataagcgaac tggcaatgat accactggcg atgaccgtta tctggtgctg       240
     gctggtcgtc tgattgagac tgttcatgat gtcctgggta agactcgaga cggccgctca       300
     agactgcgag gagcaacaga tgagaacccg ctaagcggtg gattgaggat tggcaagaca       360
     gatgcccgcg gtccagatgg cgatgggcaa tatcatcatt atctaacggt ttggatgttt       420
     gcgttgaacc ggatggctaa agcatcggga gatttgaagt acaacaggca agccatagag       480
     ctggcaaaag cgatacaccc caggttcttt gttgatcgcg cggcagctcg accgagaatg       540
     atatggaaaa tgagcatgga tctgtcagag ccgctggtca agtcagaggg taatcttgac       600
     ccgattgatg gctttgttgt tttccgactc ctgcaagata cagcgatgga agcaggtgat       660
     ggtgcattct tggccgagga aattgatgac tacaggcgca ctatggagcg aaaaggagag       720
     cactttgtct caagtgatcc tctagatctg ggtatgactt tgtggacggc ccattggttt       780
     tctgggcgag agcgctgggc tgctgacctg gcggggaaat gcttcgagca aatatacaat       840
     ctgttcgaga tcaaccaata tttggagcgc aacatcaaat ttcggttggc ctttcgtgag       900
     tttggaacct gcatgggtat ccaatgccag tcagaggtga aggagaaaga acgcacagtt       960
     gacttgaaat gctactccga cgccatcatt gctgcttggg atccatacat gcagctatcc      1020
     atatccgatg atctgacacc agcggacttg cggcctatca cgcgggtgat gtatgcgtcg      1080
     gcattaattc cagggggtaa gctaagccaa acgattctct atgatgagtc cggtattttg      1140
     acacatttcc caattccagc atttcaagct ggattcctag gaccggaacc aacaccaaca      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page