(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE246

PENCW_10.PE246       Location/Qualifiers
FT   CDS_pept        join(complement(572914..573801),complement(572608..572682))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672167"
FT                   /orf_name="Pc13g02460"
FT                   /product="Pc13g02460 protein"
FT                   /protein_id="CAP91315.1"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI0001830C39"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J9"
FT                   /transl_table=1
FT                   /translation="MATATARPVTLLSTVLLIYPATLLLGSLFSAISPTARHSRDLSGS
FT                   SPQPASPLAPSLATDLHLSESPVNYFARKNNIFNVYFVKIGWLWTTAAFVSLLIFQPLY
FT                   SPSRRESSSQQQARFRRTLQAILRYALATTVWYLATQWFFGPAIIDRGFVATGGKCERA
FT                   LEEVEKMTAGQSSPTGLETLFTAATCKAAGGAWRGGHDISGHVLMLVLATGLLAFEAVG
FT                   ASAHAPACVSQAGPTADAGRERKASDADSTPVIDSTETGGFARTWSLRLVWGVVGLGWW
FT                   MLFMTAIWFHTWLEKIALFSGMEKPSNRLHPDVETPGYT"
     atggccacag ccaccgcgcg acctgtcacc ctcctctcga ctgttctcct catataccct        60
     gccacattat tactcgggtc tttgttctca gcaatctccc caacagcacg ccattccaga       120
     gatttgtctg gctcttcccc acagcccgcg agccctctgg ccccatccct ggctacagac       180
     ctgcatctat ccgaaagccc ggtcaactac ttcgctcgaa agaataatat cttcaatgtt       240
     tactttgtaa aaattggatg gttatggacc acagccgctt ttgtctcgct cctcatattc       300
     caacccctct attctccatc tcgccgggaa tcctcgtcac agcaacaagc acgtttccga       360
     cgcacactcc aagccattct acgctacgca ctcgccacaa cagtatggta tcttgcaaca       420
     caatggtttt tcggaccggc gatcattgat cgcggtttcg tagccacggg cggcaaatgt       480
     gaacgtgctc tcgaggaagt cgagaagatg accgctgggc agagtagccc aaccggccta       540
     gaaacgctat tcacagcagc gacctgcaaa gcagccggtg gcgcatggag gggcgggcat       600
     gatatcagcg ggcatgtgtt gatgctggtt ctggccacgg gactcctggc atttgaggct       660
     gtcggggcta gcgcacacgc acccgcatgt gtgtcgcaag ctggtcccac tgcggacgcg       720
     ggacgtgaac gtaaggctag tgatgccgat agtactccgg taatcgattc aactgagact       780
     ggcgggttcg caagaacatg gtcactccgt cttgtttggg gtgttgttgg cctaggctgg       840
     tggatgctct tcatgaccgc gatttggttt cacacttggc tagaaaagat tgcattgttt       900
     tcaggcatgg aaaagccctc aaaccgtctt catcctgatg ttgaaacacc aggttataca       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page