(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE247

PENCW_10.PE247       Location/Qualifiers
FT   CDS_pept        join(complement(575773..575881),complement(575626..575637),
FT                   complement(575435..575571),complement(574750..575378),
FT                   complement(574647..574677))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672168"
FT                   /orf_name="Pc13g02470"
FT                   /product="Pc13g02470 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP91316.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001830C3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K0"
FT                   /transl_table=1
FT                   /translation="METEVIDSIDKGNGGALRTIKDLTAGAVGGMAQVMLGQPFDIVKV
FT                   RLQTTTQYKSALECATQIFKKEGPTAFYKGTLTPLIGIGACVSVQFGAYHEARRRLEEL
FT                   NKKKYANSALSYTQYYMAGSFAGLTNSVLSGPIEHVRIRLQAQPHGAGRLYSGPIDCVS
FT                   KLAAQGGALRGIYRGQAVTLLREAQAYGAWFMAFEFMMNGDAKRNNIKREDMSKAKIAI
FT                   YGGLAGEVLWLSSYPFDVIKSKMQTDGFGAEQKFSTMRDCFKKTYAIEGLGGFWKGIGP
FT                   TLLRAMPVSAGTFLTVELAMQALG"
     atggagactg aggtaattga cagtatcgat aagggcaacg gtggtgccct ccgcaccatc        60
     aaggatttaa ccgcgggcgc agtgggtgga atggcccagg ttatgctcgg tcaacccttt       120
     gacatcgtca aggtgcgcct gcaaactacc actcagtaca agagtgcgct agagtgcgca       180
     acccagatct tcaagaagga aggtcccact gccttctata agggcaccct gaccccgctt       240
     atcggtatcg gtgcttgcgt gtctgtccaa ttcggtgcct accatgaggc acgtcgccgc       300
     ttggaagagc tgaacaagaa gaaatacgcc aactcggccc tttcttacac ccagtactac       360
     atggccggtt cattcgccgg tctcaccaac tccgttttgt cgggcccaat tgagcatgtg       420
     cgtattcgcc tgcaggcaca gccgcacggc gccggccgtc tgtactcagg ccctatcgac       480
     tgcgtgagca agctggccgc acagggtggt gccctccgcg gtatttaccg cggccaggca       540
     gttactctcc tccgtgaggc ccaggcttac ggcgcctggt tcatggcctt tgagttcatg       600
     atgaacgggg atgctaagcg taacaacatc aagcgtgagg atatgtctaa ggcaaagatt       660
     gccatttacg gtggtctggc tggcgaggtc ctctggctct ccagctaccc gttcgacgtt       720
     atcaagagta agatgcagac agatggattc ggcgcggagc aaaagttcag caccatgcgc       780
     gactgcttca agaagaccta tgccattgag ggtctcggtg gtttctggaa gggtattggc       840
     cctactctgc tgagagctat gcctgtttct gccggaacgt tcctgactgt cgagttggcc       900
     atgcaagcgc tcggttaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page