(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE249

PENCW_10.PE249       Location/Qualifiers
FT   CDS_pept        join(complement(582038..582097),complement(580332..581987),
FT                   complement(579876..580262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824874"
FT                   /orf_name="Pc13g02490"
FT                   /product="Pc13g02490 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91318.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830C3C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K6"
FT                   /transl_table=1
FT                   /translation="MDLKTRLRKACDACSIRKVKCDTGGPPCRSCASLDIPCTYERPSR
FT                   RRGPPNRHAEAFKKQKREPEDTASLSPADYPSAATPLATPLTNPQCASVSLSVESICSL
FT                   HTMQMLLDDFFTYIHPLVPIPHEPSFRAAFERREDVTNHTFLALLASMIGLLVASFPRR
FT                   PKLRLNTEAERTAFPNSIALVKRCLDVAIQARGTGYLDRDATVYDAAISYFLAICAGYI
FT                   YNMRRCRVYLSECRAMLQVYDLCRSPTTTNRPSSTLGPLSPLSPASVTVLDSPAHNFTE
FT                   SRGVDLITQELGRRLFYVTFVGYQTLHQMGSSDIKVHVPPETPTDRYPPLPLEIDDEFL
FT                   FSTHVEPQPSDRVSRLVGFNANVRVYSSYTALLAWEIAFGSGQIFDWEHQRNCIWDCLK
FT                   RAKSALIDVPAELSLHHPKHVSPAGLSGLGEDDTIFSYSNDHIHQERRAIQYEIQKANI
FT                   YASQLCNRSFLVEKYWSLFETFSKYGKSPKFTAPGSTTPHIKMEGRPDSVPSASASATP
FT                   TGTASSETSTQAQPHAETDYIGRMMAEERKLVIKDLFVLLRTVNEVNMEPNGASITNKI
FT                   RQVASTLLSLSHKPNQSNTEIPNLTTAAAPSPSPTTAPPGLHILTAAEAESYLHAFIET
FT                   LVRLECHSAMGDAANSADGVSPQMNGRAMSYLSDYERDQEELSQWASLKEYQQKFAEAG
FT                   GVLHQL"
     atggacctta aaacaaggct gcgcaaggcc tgcgatgcct gtagtattcg gaaagtgaag        60
     tgtgataccg gtgggccacc ttgtcggtcg tgcgctagct tggatattcc ctgcacctat       120
     gaaagaccaa gcagacgccg cgggcctcct aaccgccatg cagaggcttt caaaaaacaa       180
     aagcgggaac ctgaagatac agcgtcgctg agccctgcag actatccgtc ggcagcgact       240
     cccctggcaa cgccactcac caaccctcaa tgtgcatcgg tctccctttc ggtagaatcg       300
     atttgttctt tgcacacgat gcagatgttg cttgatgact ttttcactta catccatcct       360
     ttggtgccaa ttccacatga gccttctttt cgagcagcct ttgagcgccg ggaagatgta       420
     accaaccaca catttttggc acttttggcg tcaatgattg gactgctagt ggcttccttc       480
     cctcggcgac ctaaactccg actcaacact gaagctgagc gcaccgcttt ccccaattct       540
     atagctctcg taaagcggtg ccttgacgtt gcgatccaag cccgcgggac cggatatctt       600
     gatcgcgacg ccacagtcta cgatgcggcg atcagctatt tccttgctat atgtgccggg       660
     tatatttata acatgcgccg atgccgtgtg tacctgtcag aatgccgagc catgctgcaa       720
     gtttatgatt tatgccggtc tccgaccacc accaatcgcc cgtcctcgac attaggaccc       780
     ctcagcccac tgtcacccgc ctcggtaacg gtgctggatt caccagcaca taatttcact       840
     gaaagccgag gcgtggacct catcacccaa gagctcggtc ggcgtctgtt ttatgtcacc       900
     tttgtcggat atcagacatt acaccagatg ggctcttcag atatcaaggt tcatgttcct       960
     ccagaaacgc caacggaccg atatccacca ctcccgctgg agatcgatga cgaatttttg      1020
     ttctcaacac atgttgagcc gcagccatcc gaccgagttt cacggctagt cgggttcaac      1080
     gcaaatgtcc gcgtctacag ctcatatacc gcactgctag cttgggaaat agcgtttggc      1140
     agcggtcaaa tatttgattg ggagcatcag cgcaactgca tttgggactg tctcaagcga      1200
     gccaaatctg cactaatcga tgttcccgcc gagttgtctc tacaccatcc gaaacacgta      1260
     tccccagcgg ggttgtcagg tcttggcgaa gacgacacaa ttttcagtta ctcgaatgat      1320
     catatccacc aagaacgacg tgctatacag tatgagatcc agaaagccaa tatctatgct      1380
     agtcagctat gcaacaggtc ctttctggtc gagaagtact ggagcctttt cgagacattt      1440
     tcaaagtacg gaaagtcacc taaattcacg gccccgggca gcaccacgcc acatatcaaa      1500
     atggaaggaa ggcccgattc agtaccaagt gcaagtgcga gtgccactcc gactggtaca      1560
     gcttcgtcgg aaaccagtac ccaagcccaa ccccatgctg aaacggacta tattggccgc      1620
     atgatggctg aagagcgcaa actggtcatc aaagaccttt tcgtgttatt acgaacagtg      1680
     aacgaagtga acatggagcc gaacggtgcc agcattacca ataaaatccg ccaagtagca      1740
     tccaccctcc tcagcctctc ccacaaacca aatcaatcca acaccgaaat cccaaacctc      1800
     acaactgctg ccgcaccatc accatcacca acgaccgcgc cgccaggcct ccacatcctc      1860
     accgccgcag aggcggagtc ctacctgcac gcattcatcg agacgcttgt ccgactagaa      1920
     tgccattctg ccatgggtga tgcagccaat tctgccgacg gagtcagtcc gcagatgaac      1980
     ggccgcgcta tgagctatct gagtgattat gagcgggatc aagaagaatt gagccagtgg      2040
     gcgagtttga aggagtacca gcagaagttt gcggaagccg gtggtgtttt gcatcagctg      2100
     tag                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page