(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE25

PENCW_10.PE25        Location/Qualifiers
FT   CDS_pept        complement(59920..61287)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824587"
FT                   /orf_name="Pc13g00250"
FT                   /product="Pc13g00250 protein"
FT                   /protein_id="CAP91094.1"
FT                   /db_xref="UniParc:UPI0001830DC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H8"
FT                   /transl_table=1
FT                   /translation="MINHSFSNCDESQAQDLDPSDQDSQYAPTPGYYVHTPPSEYGFSP
FT                   SPNRCPHDGAEPLLSTPAETSKLLQLSEWEANRPDDELPASFIRYTIEWKVKVNNRSIS
FT                   EDTEQDVALTPSAYWPLILRDKLYKVIEEKVARKRRVRSDDTSIVVSINDRKQRDLKKR
FT                   FNGLNIDWSAVEKQILVWGKFHASGKELRLKIIFSYIEDDHSPRSATGRNDKRGKSSVT
FT                   KRMLNERDEQLDAEQHATGEQSIWRAVYTLMRCPSPSCHLGPHCWQDPHGKKHYQLRTH
FT                   HLKRLITYVEGGGILECQDDVPDAVREELFLEEQQKVERLRSKGNKMLAAGNCPPISIN
FT                   FMGGQHHLQSPAANSIVTSANSPPQHGQTADPLIIDGPRDLAVREYSAWQETNVVDDNL
FT                   KAQFRQACDVTLANGLDLEQIHEDHDAGFFIEKGVAVGIARRFVSDISRWVRHVRN"
     atgattaacc actccttctc caactgtgat gaatcccaag cccaggacct cgatccctca        60
     gaccaggatt cgcaatacgc tccaactcca ggatattacg tacacacgcc accctcagaa       120
     tatggattca gcccttcacc gaaccgttgc ccccatgacg gtgccgagcc cttactgtca       180
     accccagcag aaaccagtaa gctgcttcag ctctccgagt gggaagcaaa taggccagat       240
     gacgagcttc ccgccagctt tattcggtat actatcgagt ggaaagtcaa agtgaataac       300
     cggtccatat cagaggacac ggagcaggac gtagcgctga ctccaagtgc ttactggccc       360
     ttgatcctca gggacaagct gtataaggta atcgaggaga aagttgctcg caaacgaagg       420
     gtcaggtcgg acgacacatc tattgttgtc tcgatcaacg atcgtaagca acgggacctg       480
     aaaaagcggt tcaatggcct caatattgac tggtccgctg tggaaaaaca aatactcgtt       540
     tgggggaagt ttcatgccag cggtaaagag ttgcggctga agattatctt cagctatata       600
     gaggacgatc actctcccag aagcgcaaca ggcagaaacg acaaaagagg aaagtcatct       660
     gtgaccaaaa ggatgctcaa tgaacgggat gaacaactgg acgccgaaca gcatgcaact       720
     ggggaacagt cgatctggcg ggcagtctac accttgatgc gctgtccatc accatcatgt       780
     catcttggtc cgcactgctg gcaggaccca catgggaaaa aacactatca gctaaggaca       840
     catcatttga aacgcctgat cacttatgtt gaaggtggtg gcattctgga gtgtcaagat       900
     gatgttcctg acgctgttcg tgaagagctc ttcctggaag agcagcagaa agtggaaaga       960
     ctacgatcta aaggcaacaa aatgcttgct gcaggcaatt gtccacctat tagtatcaac      1020
     ttcatgggag ggcagcatca cctgcaatca ccggcggcca actcaattgt aacgtcggct      1080
     aattctccac cgcaacatgg acaaacagct gatccgctca taattgacgg gccccgagat      1140
     ttggctgtga gagaatacag cgcatggcaa gaaaccaatg tcgtcgacga caatttgaag      1200
     gctcagtttc gacaggcatg cgatgtaacg ctggccaacg gtctggatct ggaacagatc      1260
     catgaggacc atgacgcggg attctttatt gaaaaaggag ttgcggtagg aattgcacgc      1320
     cgcttcgtaa gtgacattag tagatgggtg aggcacgtaa gaaactga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page