(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE252

PENCW_10.PE252       Location/Qualifiers
FT   CDS_pept        join(584952..585137,585248..585826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949844"
FT                   /orf_name="Pc13g02520"
FT                   /product="Pc13g02520 protein"
FT                   /protein_id="CAP91321.1"
FT                   /db_xref="UniParc:UPI0001830C3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K4"
FT                   /transl_table=1
FT                   /translation="MTSGENYAVFRECLSNAIVARSEEKPTRRKPKVKRAERKDVKTAT
FT                   TFSTRRADPEELAEFVDFLASETFAIFPTPLQTLSYAAIQHDPSLSALYIPPDTDTPLP
FT                   RATLETIFSPIPVSVTDSLLVYGIIPDRADLVDFLAPVLTEYISSVTTGPPAWASTRAD
FT                   ACEICERDWIPLSYHHLIPRGVHAKVIKKGWHDEWMLNSVAWLCRACHSFVHRMASNEE
FT                   LAREWFTVERICEREDVQDWAKWVGRVRWKAR"
     atgacgtccg gtgagaacta tgctgtgttc cgggaatgtt tgtctaatgc catcgtggcc        60
     cgctccgagg aaaagccaac gcgacggaag ccaaaagtca agcgcgccga gcgcaaagat       120
     gtaaaaacag cgacaacatt ttcaaccagg agagcagacc cggaagagct ggccgaattc       180
     gttgatttcc tagcctcaga aactttcgcc attttcccaa ctcccctcca aactctaagc       240
     tacgcagcca tccagcacga cccgagtcta tcagccctct acattccccc agacaccgac       300
     acacctctcc cacgcgccac gctcgaaacc atattctccc caatcccagt tagcgtaacc       360
     gactcgctgc tcgtgtacgg cataatcccc gacagagcgg acctggtgga ctttctcgcc       420
     cccgtgctga cagaatacat ctcgagcgtg acgactggcc cgccggcatg ggcgagcacg       480
     cgcgcggacg cgtgcgagat ctgcgagcgt gactggatcc cgctatcgta tcaccatttg       540
     attccgcgcg gggtacatgc gaaggtcatt aagaaggggt ggcatgatga gtggatgttg       600
     aatagtgtgg cgtggctttg tcgcgcttgt catagctttg tgcatcgcat ggcaagtaat       660
     gaggagctgg ctagggagtg gtttactgtt gagaggattt gtgagaggga ggatgtgcag       720
     gactgggcta agtgggttgg gagggttaga tggaaggcga ggtag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page