(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE253

PENCW_10.PE253       Location/Qualifiers
FT   CDS_pept        join(complement(587890..588090),complement(586128..587858))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129236"
FT                   /orf_name="Pc13g02530"
FT                   /product="Pc13g02530 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91322.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003566"
FT                   /db_xref="UniParc:UPI0001830C40"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K5"
FT                   /transl_table=1
FT                   /translation="MLRFQFFLFLLLPWMASAGPIFRWLSPSLESPEPTSLPLLPDIER
FT                   REPGGITAITPVAAPTQLPFTPTIKPTKLTIFPKPTTTPEPTATPEPTTTPEPTATPEP
FT                   TTTPEPTTTPEPTATPEPTATPEPTTTPEPTTTPEPTTTPEPTATPEPTTTPEPTTTPE
FT                   PTATPEPTTTPEPTATPEPTTTQEQATTKKSTTISHASTTTRLSISSSTTPGVLHSSPI
FT                   TSSLPVHVPGSTSSLGSLVIPSSAQSPSDSLPGGATSIKATTATPSVSTSTSTQPTTTP
FT                   VPTVPTSSSIAVGAIAPLGGASSSSSSTSTPVIPTSNPIQPAKATQAQSTSLQQISTSS
FT                   SKPVVTVTEPVIVYVTKGAPKPFSTSVIHHTPSVNNSPVSSAKPTVKPSVEPTTTSLMF
FT                   VTIHSTATSVVRVTVYPSSSSSSSSSSSSSSSSSASSYSALSSSTGSAPSVNAAPIVLT
FT                   TINSATQSLSSSSLLLSSSSEIAPVVTAHVTSTSVVPLTVYPATSPPASSLLPPSSEAA
FT                   SIVTVRVTSTSVVPVTVYSTTSPSAPLLPSLSETAPVVTVHVTSTKTLLVTSYGSTATA
FT                   AETTHPADPTSAVDANIATPTSKQGQGILTVIPVTPPGFVTITETETETKTVTDRITET
FT                   VTATVTRG"
     atgcttcgct ttcagttctt tttgttcctt cttttgccat ggatggcttc ggctggtccg        60
     atctttcgct ggctgtctcc gtcattggag tcacctgagc cgacttctct tcccttattg       120
     cctgatatcg aacggcgtga acctggcggt atcactgcga tcacacctgt ggcggcacct       180
     acgcagctac cgtttacgcc cactattaag ccaaccaagc taaccatctt tccgaagcca       240
     actacaacgc cggagccaac tgcaacgccg gagccaacta caacgccgga gccaactgca       300
     actccagagc caactacaac tccagagcca actacaacgc cggagccaac tgcaactcca       360
     gagccaactg caaccccaga gccaactaca actccagagc caactacaac gccagagcca       420
     actacaactc cagagccaac tgcaactcca gagccaacta ctacgccgga gccaactaca       480
     actccagagc caactgcaac tccagagcca actactacgc cggagccaac tgcaactcca       540
     gaaccaacta caactcagga gcaagctaca accaaaaagt cgaccaccat ctctcatgca       600
     tccactacga ctcggctatc catatcctca tccacaaccc cgggagtgct gcattcatcg       660
     cccataacta gttcattacc tgtccatgtt ccaggctcaa catcttccct cggctccttg       720
     gtgataccga gttcagccca atctccgtcg gattcgctac caggtggagc aaccagcatc       780
     aaagctacga cagccacacc gtcggtctca acctctacga gcacacagcc aacgacaaca       840
     ccggtgccta cagtgcccac aagtagcagt atagctgttg gagctattgc accccttgga       900
     ggagcaagta gcagcagttc ttccacgtcc acaccggtta ttccaacctc caatcctatc       960
     cagccagcaa aggctacgca ggcacaatct acatcactac agcagatttc cacgtcaagc      1020
     tccaagccag ttgtgaccgt aaccgagcct gtgatcgtat atgtgaccaa aggagcacca      1080
     aagcccttct cgacaagcgt catccaccac acacccagtg tgaacaactc accggtgtca      1140
     tcagcaaagc caacggtaaa accgtccgtt gaaccaacaa ctacatcttt gatgtttgtg      1200
     accatccatt ccactgcaac gtcggtcgtt cgtgtgactg tttacccatc atcatcatca      1260
     tcatcatcat catcatcatc atcatcatca tcatcatctg cttcttcgta ttcagccttg      1320
     tcgtcctcga ccgggagcgc tccgagtgtg aatgcagcgc cgattgtcct cacgaccata      1380
     aactcggcaa cacaatcact ttcttcttcc tccttgttgt tgtcctcctc tagtgagatt      1440
     gctcctgtgg tgacagctca cgtcacctcc acgagtgttg ttcctttgac tgtttatccg      1500
     gctacatcac cacctgcgtc ttcgttgttg ccgccctcaa gtgaagctgc ttctatagtg      1560
     acagtccgtg tcacttccac aagtgttgtt ccagtgaccg tttactcgac aacatcgcca      1620
     tctgctccat tgttgccctc cctgagtgag actgctccgg ttgtaacagt ccacgtcact      1680
     tccacaaaaa cacttctggt gacctcctat gggtcgactg ctacagcagc ggaaaccaca      1740
     catccagcag atcccacatc tgctgtggac gccaatatcg ctaccccaac ttccaaacaa      1800
     ggccaaggca tacttaccgt gattccggtt acgccgcctg gcttcgtcac gatcactgaa      1860
     actgagaccg agacaaagac ggtgacagat cgcattactg agactgttac tgccactgtt      1920
     actcggggtt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page