(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE254

PENCW_10.PE254       Location/Qualifiers
FT   CDS_pept        join(complement(591057..591268),complement(588913..590995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949845"
FT                   /orf_name="Pc13g02540"
FT                   /product="Pc13g02540 protein"
FT                   /protein_id="CAP91323.1"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="UniParc:UPI0001830C41"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K7"
FT                   /transl_table=1
FT                   /translation="MTNFRMGVTFAGVTLSVLVFLQLIAVFKLDSQPQSPLPGLSSNFN
FT                   QWKSRANAAAADDIFLVGAGKADVTGPVVEIAFAGYASLDQLGGGLKQRLYSRAFIFAD
FT                   PNKPDETFVYLVLDTLTGDTAVRHGVLEGLTALGGKYARYGEHNVAMTGTHSHSGPGAW
FT                   MNYLLPQIPALGFDKQSYQAIVDGAILSIIRAHENLVPGRLSFGSIDLEDTNINRSPFS
FT                   YEHNPDEERARYSANVEKSLSLIRFDRESDNKTAAILTWFPVHGTSMYNNNTLVSGDNK
FT                   GVAAYLFERSVDGDARFTDDAVIGFSQANVGDTSPNILGAWCEDGSEEMCRYEDSTCGG
FT                   RNEDCHGRGPFFREKDNGAKSCFEIGRRQYSAAKKLYEEMDTTPIKITGGSAVKSFHVY
FT                   QDMNGYTFPSPFNSSTLTTCPAALGYSFAAGTTDGPGAFDFTQNVTGPAGRNPLWKIAR
FT                   AVIHQPSKEQQQCQSPKNVLLDIGTLTEPYAWAADIIDIQVLRVGQLFLIISTSEATTM
FT                   SGRRWKEAIAKGAKDYLSVSDPLVVLGAPSNSYAHYVTTEEEYGAQRYEGGSTLYGPNT
FT                   LAAYVNLTLTYLPYLGSSLEVAKLPAIQPGPSPPINTNRSLSFIAGVVYDGAPIGKHFG
FT                   NVTSNPGSGPYGPGDIVKTTFVGANPRNNLHLESTYAAVERKNDYGTWEVVRNDRDWNL
FT                   VFTWKRTNEILGHSEVTIEWEIEDEYYSIDTTSPPQAGTYRMHYYGDSKNPLGQISPFE
FT                   GISGTFTVKTS"
     atgactaact ttcgcatggg cgttactttt gctggggtga ctctttcagt gctggtgttt        60
     ttgcagctga ttgcggtatt caagctcgat agccagccac agtcgccttt gcctggcttg       120
     agttcaaact tcaatcagtg gaaaagcaga gcgaacgcgg cggcagctga tgatatcttt       180
     ttggtcggag caggcaaggc agacgtgact gggcccgttg tggagattgc cttcgctggc       240
     tatgctagct tggaccaact aggtgggggt cttaagcaga gattgtattc tcgtgccttc       300
     atcttcgcag acccaaacaa gccagatgaa acctttgtgt acctggttct cgacacactt       360
     acgggtgaca cggccgtgcg acatggggtc ctggagggtc tcactgcgct gggcgggaag       420
     tatgcacggt acggcgaaca caacgtcgca atgacgggga cacattcgca ctccgggcct       480
     ggagcgtgga tgaactactt gttgcctcag atcccggcgt taggcttcga caagcaaagc       540
     tatcaagcca ttgtcgatgg cgctattcta tcaattatcc gtgcccatga gaacttggtg       600
     ccgggtcggc tctcttttgg atccatcgac ctggaagaca ccaatatcaa tcgcagtcct       660
     ttttcctacg agcataaccc cgacgaggaa cgagcgcgct attctgccaa tgttgaaaaa       720
     tcactctccc tcattcggtt tgaccgcgaa tctgacaaca aaacagcggc tatcctaaca       780
     tggttccctg ttcatggcac atctatgtac aacaacaaca ctctggtcag tggcgataac       840
     aaaggtgtcg cagcttacct cttcgagcgc agcgtcgatg gcgatgcgag gttcactgac       900
     gatgccgtaa ttggattctc tcaagcgaat gtcggggaca catcccctaa tatcctggga       960
     gcttggtgcg aagatggctc cgaagagatg tgtcgatacg aagatagcac ttgcggtggc      1020
     agaaacgagg attgccatgg tcgaggtcct ttcttccgtg agaaagacaa cggagcgaag      1080
     agctgctttg agattgggcg ccgccagtac tcagcagcaa agaagcttta cgaagaaatg      1140
     gataccaccc ccatcaaaat cactggaggt tcagcggtga agtctttcca tgtgtaccaa      1200
     gacatgaatg gctacacttt cccatctccg ttcaactcta gtacactgac gacttgtcct      1260
     gcggctttgg ggtactcttt tgccgctgga actacagacg gacctggtgc ctttgacttt      1320
     acccagaatg ttactggtcc agctggacgc aaccccctgt ggaaaattgc gcgtgctgtg      1380
     attcaccaac ccagtaagga gcagcaacag tgccaaagtc ccaagaacgt gctattggat      1440
     atcggcactc taactgaacc ttatgcatgg gccgcggata ttattgacat ccaggtcttg      1500
     cgagtgggtc agctgttcct cattatatcc accagcgaag ctaccacgat gtctgggcga      1560
     cgctggaagg aggctattgc aaaaggagca aaggactacc tttctgtttc cgatcctcta      1620
     gtggtactcg gagctccgtc gaacagttac gctcactacg tgacaacaga ggaagagtac      1680
     ggcgctcagc gctacgaggg cgggtccact ctctacggcc caaacacatt ggcagcctat      1740
     gtcaatctga ccctcactta cttgccatat ttgggaagct cgttagaagt ggccaaactt      1800
     ccagccattc aacccggccc cagcccacca attaacacca accgttcatt gagcttcatt      1860
     gcaggagttg tgtatgatgg agcgcccatt ggcaagcatt ttggaaatgt gacttcaaac      1920
     ccagggagtg ggccctatgg ccccggagat attgtgaaga cgacctttgt gggtgccaat      1980
     ccgcgcaaca atctgcacct cgaatcgacc tacgctgcgg ttgaaagaaa aaacgattat      2040
     ggcacatggg aggttgtgcg taatgaccgt gactggaatt tggtcttcac atggaagcgg      2100
     accaatgaaa ttcttggcca cagtgaggtg acgattgaat gggaaataga ggatgagtac      2160
     tatagtatcg acactacgtc ccccccgcag gctgggacct atcggatgca ttattatgga      2220
     gactcaaaga atcctcttgg ccagatctcg ccattcgagg gtattagtgg gactttcaca      2280
     gtgaaaactt catag                                                       2295
//

If you have problems or comments...

PBIL Back to PBIL home page