(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE257

PENCW_10.PE257       Location/Qualifiers
FT   CDS_pept        join(596531..596862,596921..597297,597359..597635,
FT                   597699..598428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129238"
FT                   /orf_name="Pc13g02570"
FT                   /product="Pc13g02570 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91326.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C44"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L0"
FT                   /transl_table=1
FT                   /translation="MAAQHSNSESQEKWPQNTETVSQDTDSIESVSTVETQTDRDALGK
FT                   TLTARASRTSHMSLSERVTTIATNATADPDYEVDWDGDDDPENPKNWNLKYKSMGIVFL
FT                   SWNTLIVVLYSTSYTSGITLMAEEFAQSGTIVTLGLTFYLFGLAIGSMFMAPLSEVYGR
FT                   KPVCVICLAVFTVLIIPCALAKSVTALIVVRFIAAFFGSVMISTAPGMVADLVDDEHRA
FT                   LAISVWSIGPLNGPVIGPVIGGFVTQYLGWRWMCWIALILSAIALVFAILLKETYAPTI
FT                   LQKKAARLRKETGESRWWSRYDQKASLPEILKLNLSRPFVMAVTEPICIFWNIYIAIIY
FT                   GILYLCFVAYPIVFRDIRGWQLGVSGLAFLGIGIGVLLTIACEPLIRRLVNSHPKDPET
FT                   GKPHPEAMVAFVCICATIIPVGELWFAWTCSPASIHWIVPILAGIPFGAGNTGVFIYAS
FT                   NYLTHSYGMYAASALAGNSVIRSILGGVLPLAGSSMYASLGPNWAGTLLGLLEVVIVPI
FT                   PFVFYKYGHKIRMKSPLIVRMQEEKTKLEGKRAKRQLRLQQVNQADEKKVEEAV"
     atggcagctc aacactccaa ttcggagagc caagaaaaat ggcctcagaa cactgagacg        60
     gtgtcccagg acacagactc tatcgagtcc gtgtctacgg tagagacaca gaccgaccgc       120
     gatgcactag gaaagacatt gacagctcgc gcctctcgga cctcgcatat gtctctgtcg       180
     gagcgtgtaa cgacaatcgc aaccaatgcc accgctgacc ccgactacga ggtcgactgg       240
     gatggcgatg atgaccctga gaaccccaag aactggaatt taaagtataa gtccatgggc       300
     atcgtgtttc tatcatggaa tactctcatt gtcgtgttgt attcaacttc ttatacatca       360
     ggtattacat taatggccga ggaattcgcc caatccggga ctatcgtcac gcttggtttg       420
     accttctatc tatttggtct tgccattggg tccatgttca tggccccgtt gagcgaggtc       480
     tacggacgca aacctgtctg tgtaatatgt cttgccgtgt tcacagtcct gatcatcccc       540
     tgcgcgctcg cgaagtccgt cacagcactg atcgttgttc ggtttatcgc tgctttcttt       600
     ggcagtgtta tgatatccac agcgcccggt atggtggctg atttggtaga cgatgagcac       660
     cgcgctctgg cgatctctgt ttggagtatt gggccactca acggaccagt catcggccct       720
     gttatcggag ggttcgtcac tcaatatctt ggctggcgct ggatgtgctg gatcgcgctc       780
     attctctccg ctatcgcttt ggtctttgct atcctcctca aggaaaccta cgcaccaacc       840
     attctccaaa agaaagcagc cagactccgc aaggagaccg gcgagtcccg ctggtggagt       900
     cgctatgacc aaaaggcgag ccttcccgaa atcctcaagc tgaacctcag ccggccattt       960
     gtaatggcag tcaccgagcc aatttgcatt ttctggaaca tctacatcgc aatcatctat      1020
     ggcatcctat acctctgctt cgtagcttac ccaattgtct tccgagatat ccgcggttgg      1080
     caactgggcg tgtctgggct cgccttcctg ggtatcggga ttggcgtcct cctcacaatc      1140
     gcctgtgaac ccttaatccg gcggctagtc aacagccacc ccaaagaccc cgagacggga      1200
     aaaccacacc cagaagcaat ggtcgcgttc gtctgcatct gcgcaacaat tatcccagtc      1260
     ggtgagctct ggttcgcatg gacatgttcc ccagcctcga ttcactggat cgtgcccata      1320
     ctcgcgggta tcccgttcgg cgcgggaaac actggtgtct tcatctatgc gtccaactac      1380
     ctgactcaca gctacggcat gtatgctgct tctgctttgg cgggtaattc ggttattcgg      1440
     agtatcctcg gtggtgtcct gcctcttgct ggctcttcta tgtatgccag tctggggccg      1500
     aattgggccg gcactctgct ggggctgttg gaagttgtga ttgtgccgat tccgtttgtg      1560
     ttctataagt atggacataa gattcgtatg aagagtcccc tcattgtgcg catgcaggag      1620
     gagaagacga agctggaggg caagcgggcc aagaggcagc ttcggcttca gcaggtgaat      1680
     caggcggatg agaagaaggt ggaagaggcg gtttag                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page