(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE259

PENCW_10.PE259       Location/Qualifiers
FT   CDS_pept        join(599628..599802,599899..600103,600186..600394,
FT                   600452..600531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949847"
FT                   /orf_name="Pc13g02590"
FT                   /product="Pc13g02590 protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAP91328.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001830C45"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L1"
FT                   /transl_table=1
FT                   /translation="MWSWFGGAAAQKRKDAPKNAILQLREQLDMLQKRERHLETQISEQ
FT                   EAMARKNVNSDKNAAKNALRRKKVHEKNLEQTTAQIMQLEQQIYSIEAANINHETLAAM
FT                   KQAGAAMKQIHGGMKLEDVDKTMEELQDQHALSAEIGSVITSFPIGEQPDEDELDAELG
FT                   NLEQEALDAKMLHTGPVPVGSQLDRLPAAGNTDLKQPAKAQEEDDEEAELAKLRAEMAM
FT                   "
     atgtggtctt ggtttggcgg ggccgccgct cagaagcgga aggatgcgcc caagaacgct        60
     atcctacagt tgcgcgagca gttggatatg ctgcagaaac gcgagaggca tctcgaaaca       120
     cagatctcgg aacaggaggc tatggcgcgc aagaacgtta actcagataa gaatgccgcc       180
     aaaaacgccc tccgacgcaa aaaggtccac gaaaagaatc tcgagcagac aacagctcag       240
     attatgcaac tcgagcagca gatatactcc atcgaagccg cgaatatcaa ccacgagacc       300
     ttggctgcaa tgaagcaggc cggcgccgct atgaaacaga tccacggtgg aatgaagctc       360
     gaggatgtcg acaagacgat ggaggaactc caagaccagc atgcgctcag tgccgagatc       420
     ggaagcgtca ttaccagttt ccctatcggc gaacagccgg acgaggacga gctcgatgcc       480
     gagttgggga atctggagca ggaagctctg gatgcaaaga tgctccacac cgggcccgta       540
     cccgtgggca gtcaactgga ccggttacca gctgcgggga atacagatct caaacagccc       600
     gccaaggcac aagaggaaga cgacgaggaa gccgagctgg caaagctgcg cgcggaaatg       660
     gccatgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page