(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE26

PENCW_10.PE26        Location/Qualifiers
FT   CDS_pept        join(62431..62649,62706..62858)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824588"
FT                   /orf_name="Pc13g00260"
FT                   /product="Pc13g00260 protein"
FT                   /protein_id="CAP91095.1"
FT                   /db_xref="UniParc:UPI0001830DC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H9"
FT                   /transl_table=1
FT                   /translation="MAPVESPIKQEQLRKRRIKQEQLRKRRNNLLRRHNDFWRLYSIKS
FT                   WVVMEMPNGRLYTYYSHPDVAVPTKQEIAQRPQPAVHKSPPDYGPHESANEAIPKLPAI
FT                   TVLGRCNELWSTLSHYITR"
     atggcgccgg ttgaaagtcc tataaaacag gagcagctgc gcaagcgccg cataaaacaa        60
     gaacagctgc gcaagcgccg caataatctt ctacgccgtc acaatgattt ctggcgcttg       120
     tattcaatca aaagttgggt agttatggaa atgccgaacg gccgcctcta tacctactat       180
     tctcaccccg atgtcgctgt cccaactaaa caggaaatag ctcaacgtcc tcagcctgcg       240
     gtccacaaat ctccacccga ctatggcccc catgagtcgg ccaatgaagc aataccgaag       300
     ctgccagcga ttactgtttt gggtcgttgc aacgaactat ggagtacttt gtcacactac       360
     ataacaaggt ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page