(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE260

PENCW_10.PE260       Location/Qualifiers
FT   CDS_pept        join(complement(605096..605144),complement(604844..604987),
FT                   complement(603847..604768),complement(603174..603786))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129239"
FT                   /orf_name="Pc13g02600"
FT                   /product="Pc13g02600 protein"
FT                   /protein_id="CAP91329.1"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI0001830D07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E6"
FT                   /transl_table=1
FT                   /translation="MPRKLRAAAQAAAKSIKNVPSIPDGSDEEMVDVPSSHSSSPIAEQ
FT                   EDSPEKDPDVELEAEPESKQEELAAATPAGDSILADTDNTPSYGPGRPSLPPRGKRRIG
FT                   RPPKYPRPEWNPADGEQPLRVTTPVKRRRGRPAASGGRWARNRGPSHLTQVPVDKEGNM
FT                   MDVINDEVSIPPDPIGATKVDENGHLQGGREYRVRTFKILGRGDRLYMLSTEPARCIGF
FT                   RDSYLFFQKHKMLYKIIIDDDAKRDLIERDLIPHSYKGRAIGVVTARSVFREFGAKIIV
FT                   GGKKITDDYDEAAARERGDVEGELAVPEDRLPGPGETYNRNQYVAWHGASSVYHTNAPA
FT                   VPLVGGKPVDTKKRRVPVTDDNWMLEHARAASNFNSKLAEMRRKNLGGVYDVHTNIMQH
FT                   PKIMQPTHARWERVSPAPASVPTELTANMNLLNLSNGGSPSAHENQTSHETQESHEATT
FT                   GETATERLATTFSPVPAHLHDRCVIQDIVYESPPYSNMGIPGPDGDVHDIGPNGLVSVA
FT                   NPEHPEFMTPEILELLPPGCKEALVDAAAQEVEWKSKWTSETKDGERTQPTKSYAWYP"
     atgccacgaa agctaagagc ggccgctcag gcggctgcaa agtcgataaa aaatgtacct        60
     tcaattccag atgggtctga tgaagagatg gtcgacgtcc cttcttctca ttcctcctcg       120
     cccatagccg aacaagaaga ctcccccgaa aaagatccgg acgtcgaact cgaggctgaa       180
     cctgaatcta aacaggaaga attggctgct gcgacccccg caggagactc aattcttgcc       240
     gacacagaca acacaccctc ctacggacct ggccgcccat cacttccgcc tcgcggcaag       300
     cgtcgcattg gtcgcccacc caagtaccct cgtcctgaat ggaatccagc cgacggcgag       360
     caaccacttc gagtcactac tccagttaaa agacgccgtg gtcgtcctgc tgctagcggt       420
     ggacgctggg cacgcaaccg cggcccttcc catctcaccc aggtgcctgt tgacaaggaa       480
     ggaaacatga tggatgtaat aaacgacgaa gtgtcgattc cgcccgaccc aatcggtgct       540
     accaaagtcg acgagaatgg ccacctacaa ggcggtcgtg agtatcgagt ccgtaccttc       600
     aagattcttg gtcgcggaga ccgcctctac atgttgtcga ctgaaccggc ccgctgcatt       660
     ggcttccgtg actcgtactt gttcttccag aagcacaaga tgctgtacaa gattatcatt       720
     gatgatgacg ccaagcgtga tttgattgaa cgcgatctca tcccgcactc ttataaggga       780
     cgagccattg gtgttgtcac ggcgcgctca gtattccgcg agttcggcgc aaaaatcatt       840
     gttggtggta agaagatcac cgacgactat gacgaagctg ctgctcgcga gcgcggtgat       900
     gtggaaggcg agctggccgt tccggaagac agattgcccg gacctggaga aacttacaac       960
     aggaatcaat acgtcgcctg gcacggtgca agcagtgttt atcacacaaa tgcgcccgcg      1020
     gtcccgcttg ttggtggaaa gccagttgat accaagaaac gccgtgtgcc ggttactgat      1080
     gacaactgga tgctcgagca tgcccgggct gcaagcaact ttaactcaaa gctcgccgag      1140
     atgcgccgta agaatctggg tggtgtgtac gatgtccaca ccaatattat gcagcacccg      1200
     aagatcatgc agccaactca cgctcgatgg gagcgtgttt ccccagctcc ggcatccgtt      1260
     ccgactgagt tgacggcgaa catgaattta ttgaacctct ccaacggagg ttctccttcc      1320
     gcccatgaga accagacctc ccacgaaacc caagaatccc atgaggctac cactggcgag      1380
     accgccactg aacgccttgc cactaccttt tcacctgttc ccgctcacct ccacgaccgc      1440
     tgcgtcatcc aggacatcgt ctatgaatcc ccgccatatt caaacatggg catcccgggc      1500
     cctgatggtg atgtgcacga tattggcccc aacggcctgg tcagcgtcgc caatcccgaa      1560
     caccccgagt tcatgactcc agagatcctc gagttgcttc cgccaggctg caaggaagct      1620
     ctcgttgatg ctgcggcaca ggaggttgaa tggaagtcta agtggactag tgagaccaag      1680
     gatggtgagc gtactcagcc aaccaagagc tacgcttggt acccgtaa                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page