(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE261

PENCW_10.PE261       Location/Qualifiers
FT   CDS_pept        join(complement(607012..607260),complement(606585..606821),
FT                   complement(606459..606536))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824875"
FT                   /orf_name="Pc13g02610"
FT                   /product="Putative uncharacterized protein Pc13g02610 "
FT                   /protein_id="CAP91330.1"
FT                   /db_xref="UniParc:UPI0001830D08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E7"
FT                   /transl_table=1
FT                   /translation="MIAFFRSRSIVRMTVRPRTCGYTRVPYQKRLRGITNSPLSMRPFP
FT                   FDFDTCTYLSFPSLIALRISISTLTAGYLILASDDNIGIKSSFTHREIVTTFSFQYGPG
FT                   RALSSPCICIPGEIVRYAVVAVGRSQASTCVIGARREVPASALTCGSADLRPGSCMNDK
FT                   EKETLESFADLRFGPSDYSIHGLE"
     atgattgcat ttttcaggtc acggtcaata gtccgaatga cagttaggcc aagaacatgt        60
     ggctataccc gtgtacctta ccaaaagagg ctgagaggaa taacgaattc gcctctcagc       120
     atgcgccctt ttccctttga ctttgataca tgtacatact tgtcctttcc ctctcttatc       180
     gcgctccgaa tctctatctc cactctcaca gcggggtatc ttattcttgc atctgatgac       240
     aacatcggaa tcaagtcctc attcacacat cgcgagattg tgacaacttt cagctttcaa       300
     tacggcccgg gacgagccct cagctcccct tgcatctgca tacctggtga aattgtgaga       360
     tatgctgtgg tcgcagtggg acgctcccag gcctccacat gcgtcatcgg cgcgcgccgt       420
     gaggtcccag cctctgcact aacatgcggt tcggcggatt taagacccgg gtcgtgcatg       480
     aatgataagg aaaaagaaac actagagagc tttgccgatc tccgttttgg tccctcagat       540
     tatagtatcc atggcctcga atag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page