(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE262

PENCW_10.PE262       Location/Qualifiers
FT   CDS_pept        join(608075..608127,608418..609649,609714..611113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949848"
FT                   /orf_name="Pc13g02620"
FT                   /product="Pc13g02620 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91331.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI0001830D09"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E8"
FT                   /transl_table=1
FT                   /translation="MAAQSGPVLHGDDMKTMNSGLEDDSQDQIRSNDSTPTPTGIATPE
FT                   PDPVDKRLPSIMHNYFQVGSFSGDKASLPRLWSCLSKPSEDSQSNAHTQHSSDSSESFV
FT                   MMEQEDGPDKMEEHPSLHTPPHSLLQHESDEMELGTSPGVSSIFTTLKSYLISPTQTPP
FT                   EDHPSRRQTSLPVSSISDDPVLATHFSNPSLPPTSDAFSLIEAPLLDHEKPHVPISSEN
FT                   LAKLTESVPDGLRLKNTPPLTPRAMSNEVPAAQEKNATSAPQESAQETPPSESKPEDME
FT                   SSTDEITMKLDEAFPSQSQSEDAPASPTSTSPANGAPTGPINGKLFVKITDGRGLRPSF
FT                   DPYVVCVFEWNEYISKGARDGEEEKKRRQQESDAEEAAGRPMAIPLKTRSSSHNSAVEG
FT                   DHKGRTPVTDPHWDHEATLYVTPTQLFTWVYDRNNQEAFLGHVRLRVNLKEDHSRLEGW
FT                   FPLVARGAGDNQVSGEIHLDMKFEKTDRKQVGPNDFLVLKLIGKGTFGQVYQVKKKDTQ
FT                   RIYAMKVLSKKVIIQKKEVVHTLGERNILVRTAMTASPFIVGLKFSFQTPTDLYLVTDY
FT                   MSGGELFWHLQREGRFQEARAKFYIAELILALQHLHEHDIVYRDLKPENILLDANGHIA
FT                   LCDFGLSKANLSQNDTTNTFCGTTEYLAPEVLLDEQGYTKMVDFWSLGVLVFEMCCGWS
FT                   PFYAEDTQQMYKNIAFGKVRFPRDALSTEGRNFVKGLLNRNPKHRLGANGDAKELMAHP
FT                   FFHDINWDTLCRKEVIPPFKPQLQSETDTSNFDPEFTNAMELNNSLNLRAANVANGLMP
FT                   ASTPLSPGMQANFKGFTFVNESSIDHHLMDDSDHMEDDAMHDDHWQRGHRSGNSVDQRM
FT                   TGVQKTHDGTEPGIFNVDDTFDM"
     atggctgcgc agagtggacc cgtgttgcac ggcgacgaca tgaagacaat gaactctgga        60
     ctggaagacg attctcaaga ccagatcagg tcgaatgatt ctacccccac gccgactgga       120
     atcgcaacac ctgaacctga tccggtcgac aagcgtctgc cttccattat gcacaactac       180
     ttccaggttg gttctttctc cggtgataaa gcgagtttgc cgcggttatg gtcatgtctg       240
     tcgaaaccct ctgaggattc tcaatcaaat gcgcataccc aacactcctc cgattcctcc       300
     gagtcttttg tcatgatgga gcaggaagat gggcctgata agatggagga acatcccagt       360
     ctgcataccc ctccacattc cttgttacag cacgagtcgg atgagatgga actcgggacg       420
     agtccaggag tgtcctctat ctttacaacg ctgaagagtt acctcatttc acccacacaa       480
     actcctcccg aagaccatcc ttctcgccgt cagacctccc tcccagtatc cagcatctct       540
     gacgaccctg ttcttgccac acatttttcc aatccgtccc tccctcctac ctcagatgct       600
     ttttccctga ttgaagctcc cctcctcgac catgagaaac cgcatgtccc aatatcttcc       660
     gagaacctag ccaagctaac tgaaagcgtg cccgatgggt tgcgtcttaa gaatacccca       720
     cctcttactc cccgggccat gtccaacgag gtcccagccg cccaggaaaa gaacgccact       780
     tccgcaccgc aagagagcgc gcaagagacc ccaccgtctg agtcaaagcc ggaagacatg       840
     gaaagctcca cggacgagat caccatgaaa ctcgatgaag cattcccatc tcagtcccag       900
     tcagaggatg cgcctgcgtc accaacatcg acatccccgg ccaacggcgc gcccacgggc       960
     ccgatcaatg gtaaattgtt tgttaagatc accgatggtc gaggattgcg gccaagtttc      1020
     gatccgtatg tggtgtgtgt atttgaatgg aatgagtata tctccaaggg tgctcgggac      1080
     ggcgaggagg agaagaaacg gcgccagcag gagtcagatg ccgaagaggc tgcgggtcgg      1140
     cccatggcca ttccgttgaa gacccgatct agctctcaca acagtgctgt cgagggcgac      1200
     cacaaggggc gcacgcccgt gacagacccc cactgggatc acgaggccac cttgtatgtt      1260
     accccaaccc agctcttcac ttgggtctat gaccgcaaca accaggaagc tttcttaggt      1320
     cacgtacgtc tccgcgtcaa cctcaaggaa gatcacagcc gactagaagg ctggttcccc      1380
     ttggtcgcgc gcggtgccgg cgataaccaa gtgtctggag aaattcacct cgatatgaaa      1440
     ttcgaaaaga cagatcgaaa acaggtcgga ccgaatgact tcctcgtcct caaactcatc      1500
     ggcaaaggaa cttttggaca ggtctatcag gtcaagaaga aggacacaca gcgtatctat      1560
     gcgatgaagg ttctctctaa gaaggtcatc attcagaaga aggaggtggt acacacactc      1620
     ggagagcgca atatcttagt acgcaccgcg atgacggcct ctccgtttat tgttggattg      1680
     aagttctcct tccaaactcc aacagatctc tacctcgtga cggattacat gtcgggcggc      1740
     gaactgttct ggcacttgca gcgcgagggt cggttccagg aggcccgggc gaagttctac      1800
     attgccgagt taattctggc tctgcaacat ttgcacgaac acgacattgt atatcgggat      1860
     ctcaaaccag agaacatttt gctggatgcc aacggtcaca ttgcgctctg cgatttcggt      1920
     ctgtccaagg caaatttgtc acaaaacgac accaccaata ccttctgtgg tactactgaa      1980
     tatctggccc cggaggtatt gctcgatgag caaggatata caaagatggt cgacttctgg      2040
     tccctaggtg tcttggtctt tgagatgtgc tgtggctgga gtccgttcta cgccgaggac      2100
     actcagcaga tgtataagaa tatcgcattc ggcaaagtcc gattcccccg tgatgcgctt      2160
     agcactgagg gaagaaactt cgtcaagggt ctgctgaacc ggaatcccaa gcaccgactg      2220
     ggtgccaatg gcgacgccaa ggagctcatg gcacacccat tcttccacga tatcaactgg      2280
     gacacgctgt gtcgcaagga agttattcct ccgttcaagc cgcagctgca gtctgaaact      2340
     gacacatcga acttcgatcc cgagttcaca aacgccatgg agttgaacaa ctcgctcaat      2400
     ctccgcgccg caaacgtcgc caacggcctc atgccagcct ccacaccctt atctcccgga      2460
     atgcaagcca atttcaaggg cttcaccttt gtgaatgaga gctctattga ccaccacctt      2520
     atggatgaca gtgatcatat ggaagacgat gctatgcacg acgatcactg gcaacgaggc      2580
     caccggtcgg gtaactcggt cgaccagcgc atgacaggcg tccagaagac gcacgatggc      2640
     acagaacccg ggattttcaa cgttgacgat acctttgaca tgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page