(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE265

PENCW_10.PE265       Location/Qualifiers
FT   CDS_pept        join(614937..615027,615180..615410,615515..615555,
FT                   615838..615948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949849"
FT                   /orf_name="Pc13g02650"
FT                   /product="Putative uncharacterized protein Pc13g02650 "
FT                   /protein_id="CAP91334.1"
FT                   /db_xref="UniParc:UPI0001830D0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D2"
FT                   /transl_table=1
FT                   /translation="MFQRGYRKTSSQRKTAQSVACSRQSYGSGPVDAQRDQDVIEGVAT
FT                   GRPGSVPGYLLAALMHCPKLLEGISDGDWRHFEGEERAEELAESDRTQKALVLVADRKA
FT                   CEEGEPLSEIVDNEDEDGRLTLVCGAPQAQDAAQDAARGPVGRSGLAVRGGPG"
     atgttccaga gggggtaccg caagacctcc tctcagagga agaccgcgca atcagtagcc        60
     tgctctcgac agtcctatgg atccggacct gtagatgccc agcgggatca agatgtgatt       120
     gaaggcgttg cgacaggccg tccgggttcc gtaccgggtt atctacttgc ggcgttgatg       180
     cactgcccta agctgcttga ggggatatcg gatggcgact ggcggcattt tgagggggag       240
     gagcgggctg aggagctggc ggagagtgat cggacgcaga aggcgctggt tcttgttgca       300
     gaccggaagg cctgtgagga gggcgagcct ttgtcagaga ttgtggataa tgaggatgaa       360
     gatggacgac tcacgctggt ttgtggtgct ccccaagcgc aagacgcagc gcaagacgca       420
     gcgcgaggcc cagtcggccg ttctggtctc gccgttcgtg gcggtccagg ttag             474
//

If you have problems or comments...

PBIL Back to PBIL home page