(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE266

PENCW_10.PE266       Location/Qualifiers
FT   CDS_pept        616696..617133
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949850"
FT                   /orf_name="Pc13g02660"
FT                   /product="Pc13g02660 protein"
FT                   /protein_id="CAP91335.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001830D0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D3"
FT                   /transl_table=1
FT                   /translation="MTSKPKPAILPSTYTRTTPPETFPTPGHGDISWHTLISSPQTEST
FT                   DLCAGIATCPPATGHLCAHRHTQSEIYHILEGEGNVTIDGVVSRVQAGSTVFIPSDAEH
FT                   GIVNTGPADLRWFYVFPTGSFGDVVYRFTEDEGEAKGKAKL"
     atgacctcaa aaccaaaacc agcaatcctc ccttcaacct acacgagaac aacacctcca        60
     gaaacattcc caactccagg ccacggcgat atatcttggc acaccctaat ttcatccccg       120
     caaacagagt ccacagacct ctgcgcagga atagcaacct gtccaccagc gacaggacac       180
     ctctgcgcgc accgccacac gcagtctgag atataccata tcctcgaagg cgagggtaat       240
     gtgacgattg atggggttgt gagcagagtg caggctggga gtacggtttt tatcccttcg       300
     gatgccgagc acggcatcgt taatactggg cctgcggact tgaggtggtt ttatgttttt       360
     cctacgggga gttttgggga tgttgtttat cggtttacgg aagatgaggg ggaagccaag       420
     gggaaggcaa agttgtga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page