(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE267

PENCW_10.PE267       Location/Qualifiers
FT   CDS_pept        join(618980..619365,619447..621352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949851"
FT                   /orf_name="Pc13g02670"
FT                   /product="Pc13g02670 protein"
FT                   /protein_id="CAP91336.1"
FT                   /db_xref="UniParc:UPI0001830D0D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D4"
FT                   /transl_table=1
FT                   /translation="MSVVATRTETPVVSYNSIPENHVDYTVHSRTSSISSYRTNYTTST
FT                   APTTYSPSSPSSSYRQCDSVNSLPKLTEPIQRRVPHEVYEVIINHLEELHKGQHQTGCT
FT                   TCFQRDLHALSLTCRSWEKAVRGPLYHSIHIVGNDSPAQLKKYRLKRGSRLKLLRRTLR
FT                   ERKLLANLVYELRVPQLDLLFTTTKQGPQWQEYRDLVASVVMVCPNLERLLGLSIPYHH
FT                   EFDRLTHALSTRKKLKEHTWVLGEPAEVSELSPRDDSCPGSLGPSQMFEFLNYHTSWTS
FT                   LETMMLYGLNGNGALEPSISLRMFNLLPSLRNLCITSFNKDSFDDNTLMCLPPLESLRL
FT                   ENLPGITDAGLSQYTSRPESLSLRTLVLIEQNVESLLVISKILASLRGLERFKIVQTGK
FT                   CPTLPGDHMIFQPILASSTLKYLHWDVACPDPGTALTQLDTLPFQKPTKPSNTPNYHLA
FT                   QSIISAGFPQLEALRAPSDVEPPGALQAVCRPILKGQALLRPDRYSLPRSSHGSVNTRP
FT                   LALPAGNNLTSARIRAQTFIDMAAKDTEAGMPVLIQDYSDSYVPDNAQNSQFEDDPDQE
FT                   MDDYGIWAACERFKHKDNDHNGPKTVYEFRMPTLMGRSGFRDPATGASIPHFILRPDIP
FT                   GQELDGGLIGWKQLLASNQSLSYAAGVGVNCFNSGNPSIPPPEEPMSPSSSISRFGWGS
FT                   LSGRSMTGTSPTTPTTPLMPTSSASGSALPWEKDTCTGTWNHKAGRDWWFHMERDRPGN
FT                   SELVDIKQLF"
     atgagtgtcg tcgccactag aacggagacc cctgtggtat cttacaattc tattcccgag        60
     aaccatgtcg actataccgt tcattcacga acgtcctcga tatcatccta cagaaccaac       120
     tacaccactt caaccgcgcc gaccacatat tccccatcct caccctcttc atcttaccgt       180
     caatgcgact ctgtcaattc tcttcccaag ttaactgaac cgattcaacg ccgagtaccg       240
     cacgaggtct atgaagtgat aatcaaccat ttagaggagt tacacaaagg gcagcaccag       300
     acaggatgca ccacgtgttt tcaacgcgac ttacacgcct tatccttgac atgtcggtct       360
     tgggagaagg cagttcgagg ccctctatac cacagtatac acattgttgg aaatgactcc       420
     cccgcccaac tcaagaagta tcgtctgaag agagggagtc gcctgaagct cctgagacga       480
     accctccgcg aacggaagtt gctggccaac cttgtatatg agctacgcgt gcctcagtta       540
     gacctgctct ttaccacgac aaaacagggc ccgcagtggc aagagtaccg agacttggta       600
     gcatccgtgg tcatggtgtg cccgaatttg gaacgcctgc tgggcttatc tatcccgtac       660
     catcatgaat ttgaccgtct gacccatgct ctgtcgaccc gcaaaaagct caaagagcac       720
     acatgggttt tgggcgagcc cgcagaagta tcggagctgt ccccgcgtga tgactcctgt       780
     cctgggagtc tgggtccttc ccaaatgttc gagtttctaa attaccacac ctcgtggacg       840
     agcctggaga caatgatgct ttatggcttg aacgggaatg gtgcgttgga gcccagcatc       900
     tccttgcgca tgttcaacct tcttccctcg ttgcgaaacc tttgcattac ctccttcaac       960
     aaagactcct ttgatgataa cacattgatg tgcttgccac cattggaatc attaaggctg      1020
     gagaacctgc ccgggattac agatgctggc ctctcgcagt acacttcacg acctgaatca      1080
     ctctccctca ggacactcgt cctgatcgag caaaacgtcg agtcactgct agtcatttcg      1140
     aaaatcctcg cgtcactacg aggacttgaa cggttcaaga tagtccaaac cggaaagtgc      1200
     ccaactttgc caggtgatca tatgatcttc cagcctatcc ttgcctcatc aactctaaaa      1260
     tatctccact gggatgtggc atgcccagac ccaggcacag ccctcaccca gctcgatacc      1320
     ctccccttcc agaagcccac aaaaccctcc aataccccca actatcatct tgcccaaagc      1380
     atcatctccg ctggtttccc tcaattggaa gctctccgtg caccctccga cgtggagccc      1440
     ccaggtgcgc tccaggctgt ctgccgtcct atattaaagg gccaagcctt actccgacca      1500
     gaccggtaca gcttgcctcg cagctcccac ggttccgtga atactcgacc gctcgctcta      1560
     ccagcgggga acaatctgac ctcagctcga attcgtgccc aaacgttcat cgacatggcc      1620
     gctaaggaca ctgaggccgg catgccagtt ctgatccaag attactccga ctcgtatgtg      1680
     ccggacaatg cgcagaactc ccaattcgaa gacgacccgg accaggaaat ggacgactac      1740
     gggatctggg ctgcctgcga gcgattcaaa cacaaggata atgaccacaa cggccccaaa      1800
     acggtctacg agttccgcat gccaaccctg atgggccgta gtggtttccg ggatcctgca      1860
     acgggcgcat caattcccca cttcattctc cgtcctgata tccctggtca ggagttagac      1920
     ggtggcttga tcgggtggaa gcaactgcta gcctcgaacc agtcactgtc atatgctgcc      1980
     ggagtaggcg tcaactgctt caacagcgga aacccttcca tcccacctcc cgaggagccc      2040
     atgtcgcctt catccagcat ttccaggttt ggatggggaa gcttgagtgg gcgatctatg      2100
     acgggcacat caccaacgac acccacgaca ccgctcatgc ctacaagtag tgcatcgggc      2160
     tcggccttac cttgggagaa ggacacctgc actggaacct ggaaccacaa agccggccgt      2220
     gactggtggt tccacatgga gcgtgaccgt ccgggcaact cagagctcgt tgacattaaa      2280
     caacttttct aa                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page