(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE269

PENCW_10.PE269       Location/Qualifiers
FT   CDS_pept        join(complement(625794..626107),complement(625250..625665),
FT                   complement(624530..625188))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672171"
FT                   /orf_name="Pc13g02690"
FT                   /product="Pc13g02690 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91338.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0001830D0F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D6"
FT                   /transl_table=1
FT                   /translation="MSTLEDLDDLEQEQRDKKQDQNDGDGKKPEGDGDADMKDADKNDE
FT                   EEEMLDEDILNSSTADIVTRRRMLENEMRIMKSEFQRLTHEQSTMREKVKDNQEKIENN
FT                   RQLPYLVGNVVELLDLDVEAEAAEEGANIDLDATRVGKSAVIKTSTRQTIFLPLIGLVD
FT                   HETLKPGDLIGVNKDSYLILDTLPAEYDNRVKAMEVDEKPTEKYTDIGGLDKQIEEIVE
FT                   AIVWPMKEAERFKKIGIKAPKGALMYGPPGTGKTLLARACAAETNATFLKLAGPQLVQM
FT                   FIGDGAKLVRDCFALAKEKAPSIIFIDELDAVGTKRFDSEKSGDREVQRTMLELLNQLD
FT                   GFASDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPNEEARANILQIHSRKMSVED
FT                   SVNWAELARSTDEFGGAQLKAVCVEAGMIALRKGQSKIGHENYVDAIAEVQAKKKDTNM
FT                   GIYV"
     atgtcgactc ttgaggatct cgacgacctt gagcaggagc agagagacaa gaagcaagac        60
     cagaacgatg gcgatggcaa gaagcccgaa ggcgacggcg atgccgatat gaaagacgcc       120
     gacaaaaatg atgaagaaga agagatgctg gacgaggata tcttgaactc aagcacggca       180
     gacatcgtta cgcgacggcg gatgctggag aacgagatgc gaatcatgaa aagcgagttc       240
     cagcgtttga cgcatgagca gagcacaatg agggagaagg tgaaggataa tcaagagaag       300
     atcgagaaca acagacaact accatacctt gttggaaacg tcgtcgagct attggatctt       360
     gatgtggagg cagaggcagc agaggaaggg gctaatatag acctggatgc cacccgcgta       420
     ggcaaatccg ctgtcatcaa gacctccacc cgccagacca tcttccttcc gctcattggc       480
     cttgtcgacc acgaaacact gaagcccggt gacttgatcg gtgtcaacaa ggactcatat       540
     ctcattctgg acacactacc ggccgagtat gacaaccgtg tcaaggcaat ggaggtcgac       600
     gagaagccta cggagaagta cacagatatt ggtggtctgg ataagcagat cgaagagatc       660
     gtggaagcca tcgtatggcc tatgaaggag gcagagcgct ttaagaaaat cggcatcaag       720
     gcccctaaag gtgctttgat gtacggaccc ccaggaaccg gtaagacgct tctggcccgt       780
     gcctgtgccg ccgagacgaa cgccacattc ctcaagctcg ctggacccca actggtgcag       840
     atgttcatcg gagacggtgc caagcttgtg cgcgactgct ttgccctggc caaggagaag       900
     gcgccctcca tcatcttcat cgacgagttg gatgccgtgg gtaccaagcg tttcgactca       960
     gagaaatccg gagatcgcga agtgcagcga accatgctgg aactcctgaa tcaattggac      1020
     ggctttgcct cggacgaccg catcaaggtc ctagcggcaa ccaaccgtgt cgacgtgctg      1080
     gaccctgcac tcctgcgttc cggtcgtctg gaccgaaaga tcgagttccc cttgccgaac      1140
     gaggaagctc gcgccaacat cttgcaaatt cactcgcgca agatgtccgt cgaggacagc      1200
     gtcaactggg ccgagttggc tcgcagcacg gacgagttcg gcggtgctca gctcaaggct      1260
     gtttgtgttg aggctggtat gattgcgctc cggaagggcc agagcaagat tggtcacgag      1320
     aactacgtcg atgctatcgc cgaggtccag gctaagaaga aggataccaa catgggcatc      1380
     tatgtctag                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page