(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE27

PENCW_10.PE27        Location/Qualifiers
FT   CDS_pept        join(64208..64216,64262..64361,64411..64622,64681..64765,
FT                   64978..65000,65070..65122,65198..65267,65476..65773,
FT                   65850..66010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948690"
FT                   /orf_name="Pc13g00270"
FT                   /product="Pc13g00270 protein"
FT                   /protein_id="CAP91096.1"
FT                   /db_xref="UniParc:UPI0001830DC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H175"
FT                   /transl_table=1
FT                   /translation="MSQILDGLCYLSSFGLTHQSLSCGGILLGTNGRVKIACLDQCSEC
FT                   SPTETYTIYANTIPRITMALMQKHEKDVGIAGVNDLNQWPVDSDAFGFLSAASTEPIES
FT                   LRKHPLVAARNQPTEDLVMLARAVLCAWVSKMHITLAIIPSGHEYVYIHCVPPVAIFLF
FT                   RDYHVRLAVHYLGSLEQSHYIVNKWNRTINDLCTQVTKWSLVKANNTVLEEILRRDRIL
FT                   RRNPEQSQRSAGSPFPLESAEEPAISTPPQVDAGSLDGMAIETQRTDAQASASKRGAGT
FT                   RNFLKHKAWPAEVLKRLPLWFEDQVRKNQSQEELMQSVAPSMLSVVSIRLVDGKR"
     atgtcacaga ttctcgacgg cctatgctat ctcagtagct ttggactcac gcatcagtca        60
     ctgtcgtgtg gtggaatact gctcggcaca aatggcagag taaagattgc ctgcttggat       120
     caatgctcag aatgctcacc gactgagacc tacacaatat acgccaatac tattcctaga       180
     atcactatgg cgcttatgca aaagcacgag aaggatgtcg gaattgccgg agttaacgat       240
     ttaaatcagt ggccggtcga ctcggatgct ttcggattct tatcagcagc ctcgacggaa       300
     cccattgaat cattgagaaa gcaccccctt gtcgctgcga gaaaccaacc cactgaggac       360
     ctcgtcatgc ttgcacgagc tgttttgtgc gcctgggttt ctaagatgca tattacatta       420
     gccatcattc caagcggcca tgaatacgtt tatatacatt gtgtaccgcc ggtagcgata       480
     ttccttttca gggattacca cgtgagactc gcagttcact acctaggaag cctagagcaa       540
     tctcactata tcgtaaacaa gtggaaccga actattaatg atctctgtac ccaggttacc       600
     aaatggtcac tcgtcaaagc caataacact gtgcttgaag agatactaag aagggatcga       660
     attcttcgcc gcaatccgga gcaaagtcaa agatcggcgg gctcgccctt tcccctggaa       720
     tcagccgaag agccagcaat atctacgcca ccgcaggttg acgctggttc gctcgatggg       780
     atggctatcg agactcaaag gacagacgcg caagccagtg cttcaaaacg gggtgctgga       840
     acacggaact tcctcaaaca caaggcttgg cctgcagaag tattgaagcg gcttcctcta       900
     tggttcgaag accaagtacg gaaaaatcag tcgcaggaag agctaatgca atccgtggcg       960
     ccgtcgatgt tgagtgtggt atcgattaga ttggtggatg gcaagcgcta a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page