(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE272

PENCW_10.PE272       Location/Qualifiers
FT   CDS_pept        join(complement(631740..631831),complement(631670..631683),
FT                   complement(631573..631592),complement(631398..631507),
FT                   complement(631007..631338),complement(630476..630951))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672172"
FT                   /orf_name="Pc13g02720"
FT                   /product="Pc13g02720 protein"
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91341.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI0001830D12"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D9"
FT                   /transl_table=1
FT                   /translation="MDTESDSPQGITSSADRMVGMEHSEVRYFTSYDHHGIHEEMLKDD
FT                   VRTRSYRDSIYQNRHIFKDKVVLDVGCGTGILSMFAARAGAKHVIGVDMSSIIEKARQI
FT                   VEVNGLSDKITLLQGKMEEVNLPFPKVDIIISEWMGYFLLYESMLDTVLYARDTYLNPG
FT                   GLIFPDKATMYVAGIEDGDYKDDKIGFWDNVYGFDYSPMKEIALNEPLVDTVEMKALVT
FT                   DPCAIITFDLNTVTTADLAFKVPYALTAKRPDFIHALIAWFDIEFSACHKPIHFSTGPH
FT                   AKYTHWKQTVFYLRDVLTVEEDERVTGWVENRPNDKNKRDLDISISYKFETPDATRAAE
FT                   GGCFYRM"
     atggacaccg aatccgatag ccctcagggg atcaccagca gtgctgatcg catggttggc        60
     atggagcact ctgaagtccg ttacttcact agctacgacc accacggtat ccacgaggag       120
     atgcttaaag atgatgtgcg cacacgttcc taccgcgact ctatctacca aaaccgccac       180
     atcttcaagg acaaggtcgt cctcgatgtc ggctgtggaa ccggtattct gagcatgttt       240
     gctgctcgtg ctggcgcaaa gcacgtcatt ggtgttgaca tgtcctccat catcgagaag       300
     gcccgtcaga ttgtcgaagt caatggactg tccgataaga tcactcttct ccagggtaag       360
     atggaggaag ttaacctgcc tttccccaag gttgatatca tcatctctga gtggatgggt       420
     tacttccttc tgtacgagtc catgctggat accgttctct acgcccgtga cacctacctc       480
     aaccccggtg gtctcatctt ccccgataag gccaccatgt acgttgccgg tattgaggat       540
     ggcgattaca aggatgacaa gatcggattc tgggacaacg tctacggatt tgactacagc       600
     cccatgaagg agattgctct taacgagcct ctcgtcgata ccgtcgagat gaaggctctt       660
     gtgaccgatc cctgcgcgat catcaccttt gatctgaaca ccgtcaccac agccgacctt       720
     gccttcaagg tgccttatgc cctcaccgcg aagcgccccg acttcatcca cgccttgatc       780
     gcctggttcg atatcgagtt cagtgcctgc cacaagccca tccacttctc cactggccct       840
     cacgccaagt acacccactg gaagcagacc gtgttctacc tccgtgatgt cctcaccgtc       900
     gaggaggatg agcgtgttac cggctgggtt gagaaccgcc ctaacgataa gaacaagcgt       960
     gacttggata tcagcatctc gtacaagttc gagacccccg atgctacccg cgctgctgag      1020
     ggtggctgct tctaccgcat gtaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page