(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE273

PENCW_10.PE273       Location/Qualifiers
FT   CDS_pept        join(632518..632643,632693..633567,633629..633683)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129240"
FT                   /orf_name="Pc13g02730"
FT                   /product="Pc13g02730 protein"
FT                   /protein_id="CAP91342.1"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniParc:UPI0001830D13"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E0"
FT                   /transl_table=1
FT                   /translation="MNLGVGRANLYTLFAFVFLASLIGKSNASLGDHLPDFKECVQVCK
FT                   TENCQNGNSVLRMSNHHPNSSPRLALLTSLALHHRLLLWTCPAECDYTCQHVITDRRVS
FT                   RDPPMISPIVQFHGKWPFRRLLGMQEPFSVLFSFFNFAAHWHGMSRIQESIPAWHSLRP
FT                   YYMMFGYIGLASWSFSMIFHMRDFPLTEKLDYWAAGANVLYGLYLAVVRIFRLDLENTP
FT                   YRPTLRRFWTAICILLYTLHVGYLTFWSWDYTYNMIANVVVGIIQNLMWTGFSIFRYRR
FT                   LEKSWAAWPGMIVAWIIMAMSLELLDFPPWNGLIDAHSLWHLGTVVPAVWWYSFLIKDA
FT                   QDDIAAHRLKA"
     atgaatctgg gcgtaggaag agcgaatctc tacactcttt tcgcttttgt gtttctagcc        60
     tccctcattg gcaagtccaa cgcgtcatta ggggaccatc tccccgactt caaagaatgt       120
     gtccaggtct gtaaaacgga aaattgtcag aacggcaatt cagtgctacg tatgtccaat       180
     catcatccca acagttcccc gcgtttggct ttgctgactt ccctagctct gcaccaccgc       240
     ttgctactat ggacctgccc tgctgaatgt gactacactt gtcaacatgt aattaccgac       300
     cgtcgagttt cgcgcgatcc tccaatgatc agcccgattg tacaattcca cggaaaatgg       360
     ccattccgta ggctcctagg gatgcaggag cccttctcag tgctcttctc cttcttcaac       420
     ttcgccgccc actggcacgg catgtcccgt atccaggagt ccatccccgc ctggcactcg       480
     ctccgcccat actacatgat gtttggatac attggacttg caagctggag tttcagcatg       540
     atattccaca tgcgcgattt ccccttgacc gagaagctgg actattgggc ggctggcgcc       600
     aacgtgctgt acggtctcta ccttgccgtc gttcgaattt tccggctgga cctcgaaaac       660
     accccatacc ggccaaccct acgtcggttt tggactgcta tctgcattct gctatacaca       720
     ctgcacgtgg gttatcttac cttctggtct tgggactaca cctacaatat gatcgcgaac       780
     gtagtggttg gcattatcca aaacctcatg tggaccgggt ttagtatctt ccgatatcga       840
     agacttgaga agtcttgggc cgcctggcct ggtatgattg tggcgtggat aattatggcc       900
     atgagtttgg agttgctcga tttcccccct tggaatgggt tgattgacgc gcacagcctc       960
     tggcatctgg gtacagtggt ccccgctgtt tggtggtact cgttcctgat caaggacgct      1020
     caggacgata ttgccgcgca taggttgaag gcgtga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page