(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE274

PENCW_10.PE274       Location/Qualifiers
FT   CDS_pept        join(634098..634190,634259..634272,634379..634523,
FT                   634597..634611,634672..635163,635219..636079)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129241"
FT                   /orf_name="Pc13g02740"
FT                   /product="Pc13g02740 protein"
FT                   /function="magnesium ion binding"
FT                   /function="phosphoacetylglucosamine mutase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91343.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004610"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="UniParc:UPI0001830D14"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E1"
FT                   /transl_table=1
FT                   /translation="MASPAVKKAITEAALQYAKPEGKVFEYGTAGFRMKADLLNTVVFA
FT                   VGLLASLRSKKLSGQWIGVMVTASHNPAEDNGVKLVDPMGEMLEAEWEAYATRLANAPL
FT                   DKIADVYDELIKEIDVKMTNPARVVFARDTRASGSRLVGVLNAALTATEVEFVDLKYMT
FT                   TPQLHYVVRCKNTLGTQYEYGEPTEQGYYEKLANSFKKVMRGVKVQGSLTVDCANGVGG
FT                   PKLRELMKYLTGIDIKVVNDDVINPDALNFDCGADYVKTKQRAPPSSKAAVLDRCASLD
FT                   GDADRLVYYFLDESNVFRLLDGDRIATLAASFIGDLARNAGIASKLKIGVVQTAYANGA
FT                   STDYIEKVLKLPIICTNTGVKHLHHAALRFDVGVYFEANGHGTVTFSENALKVIKNTEP
FT                   QSPAQQHALESLQALTDLINQAVGDALSDALLVEAILAHKGWSPKEWLGTYTDLPSRLV
FT                   RVEVNDRSIFKAYDAERKLESPPGLQGTIESLQSRYNKGRSFARASGTEDAVRVYAEAA
FT                   SRSEADDLATRVANAVSEAGSA"
     atggcctctc cggctgtcaa gaaagcgatc acagaggcgg cgttgcagta cgcaaagccc        60
     gagggcaagg tatttgagta tggcacagca gggtttcgca tgaaagccga cctcctcaac       120
     accgttgttt ttgcagtggg cttgcttgca agcctacggt cgaagaagct tagcggacaa       180
     tggattggtg ttatggttac tgctagccac aaccccgcgg aggacaatgg tgttaagttg       240
     gttgacccca tgggcgagat gcttgaagct gagtgggagg catacgcgac aagactggca       300
     aatgccccat tggataagat cgccgatgtc tacgatgaac ttatcaagga aatcgacgtg       360
     aagatgacca accccgctcg tgttgtgttt gctcgtgata cccgtgcttc tggttcccgt       420
     ctggtaggtg ttctgaatgc cgcccttact gcgacggagg tcgagtttgt ggacttgaaa       480
     tacatgacca ccccacaact ccactacgtt gttcgctgca agaacaccct tggaacacaa       540
     tatgagtacg gtgagccgac tgagcaagga tactatgaga agcttgcaaa ctccttcaag       600
     aaggttatgc ggggagtcaa ggtccagggt tccctgactg tggactgcgc caacggtgtt       660
     ggtggaccta aattgaggga actgatgaag tacctcactg gaatcgatat taaggttgtc       720
     aacgatgatg tgatcaaccc tgacgccctg aacttcgatt gcggtgccga ctatgtcaag       780
     accaagcaac gtgctcctcc ttcttccaaa gctgccgtgc ttgatcgatg cgcttcgcta       840
     gacggtgacg ctgatcgtct tgtttactac ttcctagacg agagcaacgt gttccgtctt       900
     ctggatgggg atcgtattgc cacccttgcg gcgtctttca ttggcgatct tgcccgcaat       960
     gctggaattg cttcgaagct gaagattggt gttgtccaga ccgcctatgc caacggtgca      1020
     agcacagatt acatcgagaa ggtcctcaag cttcccatta tctgcaccaa caccggtgtg      1080
     aagcaccttc accacgccgc gctgcggttc gatgttggtg tctacttcga ggccaatgga      1140
     catggtaccg tcaccttctc agagaatgcc ctaaaggtca tcaagaacac cgagcctcaa      1200
     tcgcctgcgc agcagcacgc cctcgaaagc ctccaggccc tgacagacct gattaaccag      1260
     gctgtcggtg atgccttgtc cgacgcactt ctcgtggagg ccatcctcgc ccacaagggc      1320
     tggtcaccca aggagtggct tggaacctac accgaccttc cttcgcgcct cgtgcgtgtc      1380
     gaggtcaatg accgttccat tttcaaggcg tacgacgctg agcgtaagct cgaatctcct      1440
     cccggcctgc agggcactat cgagtctctt cagtctcggt acaacaaggg ccgcagcttc      1500
     gcccgtgcca gcggtactga ggatgccgtc cgtgtctacg ccgaggctgc cagccgctcc      1560
     gaggcggacg acctggccac gcgtgttgcc aacgctgtta gcgaggcagg cagcgcctaa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page