(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE275

PENCW_10.PE275       Location/Qualifiers
FT   CDS_pept        join(complement(637506..637899),complement(636362..637449))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978070"
FT                   /orf_name="Pc13g02750"
FT                   /product="Pc13g02750 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91344.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001830DCD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E2"
FT                   /transl_table=1
FT                   /translation="MPITKKRKVAHAEPAAPVEDSDASSNASSSSPQPTAENPDIGDSE
FT                   PQATADDPNVKDATSETEPSATTAPKTFKELGLIDSLCEACDKMGYKAPTPIQSESIPL
FT                   ALQGRDIIGLAETGSGKTASFVLPILQALMEKPQSFFGLVLAPTRELAYQISLACESLG
FT                   ATINVRSTTLVGGMDMVPQSIALGKKPHIIVATPGRLLDHLENTKGFSLRSLKFLVMDE
FT                   ADRLLDMDFGPILDKILKVLPRERRTFLFSATLSSKVESLQRASLSNPARVSISSSKYA
FT                   TVETLQQTYLLRPYKHKDIYLVYLLHEFIGQSVIIFMRTVHETQRVAFLLRGLGFGAIP
FT                   LHGQMSQSARLGALGKFRSKSREILVATDVAARGLDIPSVDCVLNFDLPTDSKTYIHRV
FT                   GRTARAGKSGTAISFVTQYDVEIWQRIEAAMGKELAEYPAPKDEAMVFAEQVSASQRDA
FT                   IQAMKHYDEKKGAKGKGKFSFKGKRSRDAMDQEEG"
     atgccgatta ccaagaaacg caaggtcgca cacgcggagc ctgctgcacc tgttgaagac        60
     agcgacgctt catcaaatgc aagctcttca agcccccaac ccaccgctga gaaccccgac       120
     attggagata gcgagcccca agccactgct gatgacccca atgtcaaaga tgccacctcc       180
     gagactgagc ccagcgctac taccgcccct aagacattca aagaactggg cctgattgac       240
     tcgctctgcg aggcctgcga caagatggga tacaaggccc ctacaccaat ccagtcggaa       300
     tcaatcccgc tggcactgca gggtcgtgat attattggat tagctgaaac aggatctgga       360
     aaaactgcct ccttcgttct accaattctt caagcgctca tggagaaacc ccagtcattc       420
     tttgggctcg tactggcccc aacccgtgaa ctggcatacc agatttcact agcatgcgag       480
     tcccttggtg caacaatcaa cgtcagatcc accacgttgg tcggcggcat ggacatggtt       540
     cctcagtcga tcgctttggg caagaaacct cacatcatcg ttgctacgcc cggcagactt       600
     ctcgaccacc tcgagaatac aaaaggcttc tccctccgca gcttgaagtt cctcgtcatg       660
     gatgaagcag acagactcct cgatatggat ttcggcccca ttctcgataa gatcctgaag       720
     gtcctgccgc gcgagcgcag aaccttccta ttctccgcca ctttgagttc aaaggttgaa       780
     tctctccagc gagcctccct gtcaaatccg gcccgcgtct cgatctcttc tagcaagtat       840
     gctaccgtgg agaccctcca gcaaacctat ctccttcgtc cttataaaca caaggacatc       900
     taccttgtct acctcctcca cgaatttatc ggccagtccg tcattatctt catgcgcacg       960
     gttcatgaga cgcagcgtgt tgcttttctg ctgcgcggtc taggcttcgg cgcaatccct      1020
     ctgcatggcc agatgtctca atctgcacgt ctgggagcat tgggaaaatt ccgatcgaaa      1080
     agtcgcgaga tcctggttgc caccgacgtt gctgctcgtg gtctagatat tccctctgtg      1140
     gactgtgttt tgaactttga cttgccaacc gacagtaaga cctatattca ccgagtaggc      1200
     cgtacggcac gtgccggaaa gtctggaacc gccatctctt ttgtcacgca atatgacgtg      1260
     gaaatatggc agcgtataga ggctgccatg ggcaaagagt tggccgaata ccccgctccg      1320
     aaagatgagg ccatggtctt tgctgagcaa gtgagcgctt cgcagcgtga tgccattcag      1380
     gcgatgaagc actacgacga gaagaagggc gctaagggca aaggaaagtt ctcgttcaag      1440
     ggcaagcgaa gtcgcgatgc catggaccag gaagagggct ag                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page