(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE277

PENCW_10.PE277       Location/Qualifiers
FT   CDS_pept        join(complement(640816..640846),complement(640641..640763),
FT                   complement(640039..640586))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000151757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949856"
FT                   /orf_name="Pc13g02770"
FT                   /product="Pc13g02770 protein"
FT                   /protein_id="CAP91346.1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0001830DCF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E4"
FT                   /transl_table=1
FT                   /translation="MFTGLVETIGTVTALEPIDTSSSGGGGTSLTISDCEEILTDAHLG
FT                   DSIAVNGTCLTVTAFDKTWFKVGCAPETLRRTNLGSLQANSNVNLERAVSADTRMGGHF
FT                   VQGHVDTVAEILSVTPDGNSLVFRLQPRDRDILRYVVEKGYVTLDGASLTVTKVVDGQD
FT                   GYWEVMLIAYTQGKVVTAAKKPGDLVNVEIDIVGKYVEKSVQGYFAGTSGGDFAILEKM
FT                   VNRIVDERLKK"
     atgttcacag gacttgtcga gacgattgga actgtcacgg ccttggagcc catcgacacc        60
     tcgtcgagcg ggggcggggg aacgtcgctc accatctccg actgtgagga gatcctcacc       120
     gacgcacacc tcggcgatag catcgcagtg aatgggacat gtcttacggt cactgcattc       180
     gataagacct ggttcaaggt tggctgtgcg ccggagacgt tgcgacgcac aaacctgggt       240
     tccttgcagg caaattccaa cgtcaacctg gagcgcgccg tttcggccga tacccggatg       300
     ggaggccact ttgtgcaagg ccatgtcgat accgttgcgg agattctctc tgtcacgcct       360
     gacggaaact cgttggtgtt ccggctgcag ccgcgcgata gagatattct gcgctatgtt       420
     gtggaaaagg gctacgtgac cctcgacggc gctagcttga ctgtcaccaa ggtcgtcgat       480
     ggacaggacg gatactggga ggttatgctc attgcctaca cccaggggaa ggttgtcact       540
     gcggcaaaaa agcccggtga cctagtcaac gttgagattg atatcgtggg caagtatgtt       600
     gagaagagcg tgcagggata ctttgctggt acctctggtg gggattttgc tatcttggag       660
     aagatggtga acaggatcgt cgatgaacgg ctcaagaagt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page