(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE278

PENCW_10.PE278       Location/Qualifiers
FT   CDS_pept        join(641042..641215,641274..641305,641380..641503,
FT                   641563..642067,642127..642420,642479..642690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824876"
FT                   /orf_name="Pc13g02780"
FT                   /product="Pc13g02780 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91347.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI0001830DD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E5"
FT                   /transl_table=1
FT                   /translation="MTVALRFQVAARRSGLSWGSNALRRTIPGRSYSSAVAADGSLPLA
FT                   GIRVLDMTRVLAGPYCTQXLGDLGADVIKVEHPVRGDDTRAWGPPYAKYEDASRKGPGE
FT                   SAYYLAVNRNKKSLGLSFQHKSGVEILHKLAKECDVLVENYLPGGLKKYGMDYETLREI
FT                   NPKLIYASITGYGQTGPYSNRAGYDVMVEAEMGLMHITGARDGAPVKVGVAVTDLTTGL
FT                   YTSNAIMAALIARGRTGRGQHIDACLSDCQVATLSNLASSALISGQKDSGRWGTAHPSI
FT                   VPYRSYKTSDGDILFGGGNDKLFGVLCDRLGFSEWKTDARFVTNSDRVQHRAEIDGMIE
FT                   STTMQKTTQEWLDIFEGSGMPYAAVNDIQGTLNHKHVLARDMVTEVEHPACGPIKLVNT
FT                   PIKYSEATPGVRTPPPTLGQHTDEILGSVLDYGEADIARLKDEGVVS"
     atgacggtcg cgctcaggtt tcaggttgct gcccgtcgat cgggcttgtc ctggggtagc        60
     aatgccctgc ggcgcacaat accaggacga agctactcca gtgcagttgc agctgacggg       120
     tccctgcctt tggctggtat tcgggtgctt gatatgacac gcgttttggc tggtccctat       180
     tgtactcaaa nactaggtga tctaggagcg gatgttatca aggtcgaaca ccctgtgcgc       240
     ggcgacgata ctcgtgcttg gggtccgccg tatgcgaagt acgaagatgc ttccagaaag       300
     ggtcctggcg agagcgccta ctacctcgct gtcaaccgaa ataagaaatc tctcggtcta       360
     tcattccaac acaagtcagg tgtcgagatt ctacacaagc ttgcaaagga atgtgatgtc       420
     ctagtcgaga actatctccc agggggactt aaaaaatacg gcatggacta tgaaacgctg       480
     cgggaaatca accccaagtt gatctatgcc agtatcaccg ggtatggcca gacgggccca       540
     tatagcaacc gtgcaggcta cgacgtcatg gtggaagccg agatggggtt gatgcacatc       600
     accggcgctc gggatggtgc gccagtcaag gttggtgttg ccgttaccga tctgaccacc       660
     ggactataca catcaaatgc catcatggcc gctttgattg ctcggggtcg gaccggtaga       720
     ggccagcata tcgatgcctg tttgagtgat tgccaggtcg ctacactatc gaacctggca       780
     agctctgcac ttatcagtgg gcaaaaggat tccggccgtt ggggcacagc acacccatcc       840
     attgtaccct accggagcta caaaaccagc gacggtgata ttctcttcgg cggtggcaac       900
     gataagctgt ttggcgtgtt gtgtgatcga ctgggcttct ctgagtggaa gactgacgcc       960
     cgcttcgtca ctaacagtga ccgagtgcag catcgtgcgg agatagatgg tatgatcgaa      1020
     agcaccacta tgcagaagac cacgcaggag tggttggata tattcgaggg tagcggtatg      1080
     ccttatgcgg cggtcaacga cattcaaggg accctgaatc acaagcacgt cttggcacga      1140
     gatatggtga cggaagttga gcaccctgca tgtggcccca tcaagttggt caacacgcct      1200
     atcaagtact ccgaagcgac accgggtgtg cgcacgcctc ctcctactct aggccagcat      1260
     acggatgaga tcttaggtag tgtcctcgat tatggggagg cagatatcgc tcgcttgaag      1320
     gatgagggag tcgtgtcctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page