(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE279

PENCW_10.PE279       Location/Qualifiers
FT   CDS_pept        643313..644860
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949857"
FT                   /orf_name="Pc13g02790"
FT                   /product="Pc13g02790 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91348.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0001830DD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E9"
FT                   /transl_table=1
FT                   /translation="MRVSSAFMDLPATDINPGCPQNVHEGNIFDHEGVSEAIQPLPYHS
FT                   ELIAENIPWATWGSPAPLQEEAVWTTAGAMETGQQNASAALASNRTRSGRRITQPVARE
FT                   AYPVTTKEPTVTTKGPTVKAAAKKRKRLNRQVNIVCTGCYRGHSPSNNLIVLCDSCDAP
FT                   WHQRCHNPNIDNEVIEIPETNWFCIKCKPEQRQAGWRKSGKNAMKVKKVGRPKKPGVFG
FT                   SQIGGNHYTEEERRAYLSSLSHDSLVQLVVKVSNEWPSVPLFPPDMQPVTDFTLSPAIP
FT                   HNHQASKPTPKNNARSAILDWENLESMSQNANAMDSKQRISETSDATTPAATALDADKT
FT                   FAAMVSDSVPEPAPPAALGGIPAGQIFAGSSHTHAYATAPQTSTTTTPQTPSRATRRFT
FT                   SQAAPAARHARTASFVSSYSDLLTDDESSYSQSRQQSPTPSASQSSHAESQHESDYDPG
FT                   DYRAYPEAGQGFQVPLTPSDLDIMAEDKDCLTFSHSIRGPEAQNKKPYSPFGQRKQW"
     atgagggtct catcggcatt tatggacctc cccgccaccg atatcaaccc cgggtgcccc        60
     cagaacgtcc atgagggcaa catatttgac catgagggag tctcggaggc gatccaacca       120
     ttaccatacc actcggagct tatagctgag aatataccct gggcaacatg ggggtcacca       180
     gcaccgcttc aggaagaggc agtttggaca acagctgggg caatggaaac gggtcagcaa       240
     aatgccagcg ctgccctagc ttcgaatcgg actcgatctg gccgtcgtat tactcagcca       300
     gttgctcgag aagcctaccc tgtgacaaca aaggaaccaa ctgtgacaac aaaggggcca       360
     actgtcaaag cggcagcaaa aaagcggaag cgtctgaacc gtcaggtgaa tatagtctgc       420
     accggctgtt accgaggaca cagcccctcg aacaatttga ttgttctatg tgactcgtgt       480
     gatgctccct ggcatcaaag atgccacaat ccgaatattg ataatgaggt cattgaaatc       540
     ccggagacga attggttttg catcaagtgt aaacctgagc aacgccaggc aggctggaga       600
     aaatctggaa agaatgcaat gaaagtgaaa aaggtcggac gccccaagaa gccaggcgtg       660
     tttggatctc aaattggtgg aaatcattat acggaagaag aacgacgagc gtatctttcc       720
     tctctttcgc atgattcgct agtccagctt gtagtgaaag tctcgaacga gtggccgtcg       780
     gttcctctgt ttcccccgga catgcaaccc gtgactgatt tcactctgtc acctgcgata       840
     ccacacaatc atcaggcatc caaacctaca ccgaagaaca acgctcgttc tgcaatactt       900
     gattgggaaa atctagaatc catgtctcag aacgccaacg ccatggattc aaaacaacga       960
     atcagcgaga cttccgatgc cacgactccc gcagctactg ccctggatgc cgataaaacc      1020
     tttgctgcca tggtctccga ttctgtcccc gaacctgctc ctccagcggc tcttggtggc      1080
     atccctgcgg gccagatttt cgccggaagt tctcacacgc atgcttacgc aactgctccc      1140
     cagacctcta ccacaacaac tccgcagacc ccttcaaggg cgacgcgcag atttacgtct      1200
     caagctgctc ctgcagctag gcacgctcgc acggcctctt tcgtttcctc gtactctgac      1260
     ctgctcaccg acgacgaatc atcatactcc caatcccgac aacaatcccc cactccgtct      1320
     gcgtctcagt cttcacacgc cgaatcccag catgaatcgg attatgaccc tggagattac      1380
     cgcgcttacc ccgaagctgg tcagggcttc caggtgccgt taaccccaag cgatctcgac      1440
     atcatggctg aggataagga ttgccttacc ttcagtcatt ctatccgagg cccagaggct      1500
     cagaataaga agccttattc gccttttggt cagcgcaagc agtggtga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page