(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE280

PENCW_10.PE280       Location/Qualifiers
FT   CDS_pept        join(complement(646151..646202),complement(645975..646002),
FT                   complement(645724..645755),complement(645487..645639),
FT                   complement(645389..645415),complement(645205..645305),
FT                   complement(645084..645119))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824877"
FT                   /orf_name="Pc13g02800"
FT                   /product="Putative uncharacterized protein Pc13g02800 "
FT                   /protein_id="CAP91349.1"
FT                   /db_xref="UniParc:UPI0001830DD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F0"
FT                   /transl_table=1
FT                   /translation="MAFLYFLGTGQAFGQRASVAHRTRATGIPKGFPRAPLGRSKEPSE
FT                   PQGRNRHWTTEAICWRYDSLELKWPVTCRGTGEEGRGGGGRGEVAEGQEGTWVKNXHGD
FT                   YPEYRIGDLVYPFRRLILTSSRQAKGKRRKYEESTQSL"
     atggcttttc tgtacttcct cgggacgggg caagcctttg gacagagagc cagtgttgca        60
     cacaggaccc gtgcaactgg gattcctaag ggtttcccaa gagctccgtt aggccgcagc       120
     aaagagccat cagagcctca gggtagaaac cgtcactgga caacagaggc catatgttgg       180
     agatatgact ctctggagct gaagtggccc gtcacctgcc gagggacggg ggaagagggg       240
     aggggaggag gggggagggg ggaggtggct gaaggacagg aaggaacttg ggtgaagaac       300
     nagcatggtg attatcctga atacagaatt ggcgacttgg tctatccgtt caggcgcctc       360
     attttgacca gttctaggca ggcaaagggc aagaggcgaa aatatgaaga atccacacaa       420
     agtctgtag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page