(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE281

PENCW_10.PE281       Location/Qualifiers
FT   CDS_pept        join(complement(648448..648881),complement(647618..648386),
FT                   complement(647050..647468),complement(646315..647005))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949858"
FT                   /orf_name="Pc13g02810"
FT                   /product="Pc13g02810 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91350.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0001830DD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G2"
FT                   /transl_table=1
FT                   /translation="MATSTVDEGGPVGIKKELREALDAIVSSGTFASQGRLPHVDPQIK
FT                   VQDVGAISLPLQESQLRQMMKQAHQAPYGKGSETLVDTAVRNTLELNPGQFELSNPNWD
FT                   NYIKRACTCVARDLGVDSPVSAELYKMLIYEKGAMFKPHTDTEKAPGMFATLVIGLPSP
FT                   FEGGEVAVKHQGKKMVLTTLQHGFSYVSWYSDVVHEILAVRSGYRWVLTYNLCIDPSRP
FT                   CPTACLHTDEARHLHRILKTWLNQNTAERELSHAYYRLDHEYTKANISLNALKGRDLAS
FT                   VHLLKEISNDLNMEIFLAVIAKGQMGPCRYEEPYSRKSYRSSRSYFNIYLENHNAGYRG
FT                   RSGAIHALEQIINTSYEVDTLVGLDGCEVMESMPLKNDNVLQMKCFDVDPQEDYMGYQG
FT                   NFAVVIVPRDSIAHFLKVPTERSGPYTESTCQGNKALMIGYLAKSLAHTPDDQFLIKTL
FT                   KDLCQEVWTMSETGPPGSSRPPRVVLPEAVITKVLQAAIISKDPDFVKDAVGRLERNLS
FT                   PDFFTWVQEQTAVGLITFDTIKDILLSGSIVGILSRTICSHAPAMEASDFHSLWLPFLH
FT                   HLVRFCEANSIPTSTPDYQRIFAAILKAYINNYVGERPSHDGNYVRPTVGHGCADCISL
FT                   NRFLSDPAQTVGRFSVNQKRRHHLHLRLDAAKIDCTHETERIGSPQTLVVTKSFPRHER
FT                   DSAAWGKRKAEAGVKLLDFNKRDLTGWFGEEYEGLMGMVGHGPSSGRRPAGPVPNRPTR
FT                   PRKRKAADIDVVDLRDD"
     atggcgacat ccacagttga tgagggaggg cccgttggca ttaagaagga actacgtgaa        60
     gctctcgatg ctatcgtgtc gtcagggact tttgcttcgc aaggcagact cccacatgtt       120
     gatccacaga tcaaggtgca agatgttggt gcgatttctc tgccgttgca ggaatcacag       180
     ctgcgccaaa tgatgaagca agcccatcag gcgccatatg gcaagggcag tgagaccctc       240
     gtcgacaccg cagtgcgaaa caccttggag ctcaatcctg gtcagttcga actgtcgaat       300
     ccgaactggg acaattacat caagcgagct tgcacatgcg tcgctcggga tttgggtgtc       360
     gattcgcccg tttcagcgga gctttacaag atgttgatct acgaaaaggg tgcaatgttc       420
     aaaccccata ctgacaccga gaaagccccc ggcatgtttg cgactcttgt gatcggcttg       480
     ccgtcaccct ttgaaggagg cgaggtagct gtcaagcacc aaggcaaaaa gatggtcctg       540
     acgacgctgc aacacgggtt ctcgtatgtc agttggtact cggatgttgt ccacgagatt       600
     ctcgctgtca ggtctggata tcgatgggtc ctcacgtaca acctttgcat cgatccttcg       660
     cggccatgcc caacagcttg tcttcatacg gacgaggcgc gtcatctcca cagaatcctc       720
     aagacatggc ttaatcagaa caccgcggag cgagaattga gccacgccta ctacaggctt       780
     gatcacgagt acacaaaagc caatatctca ctcaatgctc ttaagggtag agacctggcg       840
     tccgtacatc ttctcaagga gatttcaaac gacctcaaca tggagatctt cctggccgtg       900
     atagcaaagg gacaaatggg accatgtcgg tatgaggaac cctacagcag aaagtcctac       960
     aggtcttcca ggtcttactt caacatctac ctcgaaaacc acaatgcagg ctaccgtggc      1020
     agatctgggg ctatccatgc tctggagcag attattaaca cctcatacga ggtcgacacg      1080
     ctggttggcc ttgatggttg tgaagtaatg gaaagtatgc cattgaagaa cgacaacgtt      1140
     cttcagatga agtgtttcga cgttgatcca caggaagact acatgggcta tcagggaaac      1200
     tttgccgtgg tcatagtgcc cagagattcg attgctcatt tcctcaaggt tcctacggag      1260
     agaagcggac cttacacaga gagtacatgt caaggaaaca aggcattgat gattggctac      1320
     cttgccaagt ctcttgcaca cacacctgac gaccaatttt tgatcaagac tttgaaagac      1380
     ctctgtcagg aggtctggac tatgagtgag accggaccgc ctggcagctc tcgtcctccc      1440
     agagttgttc ttcccgaggc cgtcattacc aaggtccttc aggccgctat catctcgaag      1500
     gatccagact tcgtcaaaga tgctgtgggc cgcctcgaga gaaatttgtc tcctgatttc      1560
     ttcacatggg ttcaagagca aactgccgtt ggtctcatca cttttgatac catcaaggac      1620
     atattgctta gcggttcaat cgtcggtatt ctctcccgca cgatctgttc ccatgctcct      1680
     gccatggagg cgtccgactt ccattcgctc tggctcccat tcctacacca tttggtcagg      1740
     ttctgcgaag caaattcgat accgacatct acgccagatt accaacggat cttcgctgcc      1800
     attctgaaag cctacatcaa caactacgtc ggtgaaaggc cttcccacga cggtaactat      1860
     gttcgaccca ccgtgggaca tggttgcgcc gattgcatct cgctcaacag attcctgagt      1920
     gacccagccc agacagttgg caggttctcc gtcaaccaga aacgcagaca tcatctgcat      1980
     ctcagactcg acgctgctaa gatagactgt acgcatgaaa ccgagcgaat cggatcgccg      2040
     caaacattgg tcgtgaccaa gtctttccct cgtcatgaac gggattctgc agcatggggg      2100
     aaaagaaagg cggaagcggg agtcaagctc ctcgacttca acaagaggga tttaactggg      2160
     tggtttggag aggaatacga gggacttatg ggtatggttg gtcatggacc ctcttctggt      2220
     cgacgtccag caggaccggt gccgaaccga ccaacacggc cgaggaagag aaaggcagca      2280
     gatatcgacg tggttgattt gagagatgat tga                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page