(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE282

PENCW_10.PE282       Location/Qualifiers
FT   CDS_pept        join(650582..651107,651273..651856)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672173"
FT                   /orf_name="Pc13g02820"
FT                   /product="Pc13g02820 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91351.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830DD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G3"
FT                   /transl_table=1
FT                   /translation="MTSSTPQLLRTTAKPSHPAPGTTNSHTNFLTIDTLISILSKSLLN
FT                   PFVAWIFVLCLRAQVTPSTDPAWILAVSYATVLTVLSIARLINQRAADGVPRTVDFEHE
FT                   VVVITGGASGLGLLIAQMYSMRGASVAVLDIKAVPENSRDEIFGEGVLYITCDVADRGA
FT                   LEVAKERILQEVGTPTIVINCAAARINGLSLLDLPADAFEKTIRTNLLAAFHLYQVFLP
FT                   GIIAAESGGTLATVSSVLGQLSAAGLSDYAASKAGLSALHRTIEAEIRGNPLIKTLLVE
FT                   VGQMSTPLFDWVRAPNNFFAPVLEPVEVAREMVAAIDSGRGGVIRLPIYAKLVNWYAVL
FT                   PATVQRVARYLSGIDAAVNQSRETSGKTD"
     atgacatcct caacccccca gttgctaaga acaacagcca aaccatccca cccagccccc        60
     gggacaacca attcacacac caacttcctg acgatcgaca ccctaataag catcctctcc       120
     aaatccctcc tcaacccctt tgtagcctgg attttcgtcc tctgcctgcg tgcccaggtc       180
     acaccatcaa cagacccagc ctggatcctc gccgtgagct atgcaacggt cctgacagtc       240
     ctttccatcg cgcggcttat caaccagcgc gccgccgatg gcgttccgcg cactgtcgat       300
     ttcgagcatg aggtcgtggt catcaccgga ggggcgagtg ggctaggttt gttgattgcg       360
     cagatgtata gcatgcgcgg ggcgagtgtc gctgtgctgg atatcaaggc tgttccggaa       420
     aacagccgcg acgagatctt tggggagggc gttctgtata ttacgtgtga tgtcgcggac       480
     agaggcgcgt tggaggttgc taaggagagg atcttgcagg aggtaggaac accgacgatc       540
     gttatcaact gtgccgcggc taggatcaac ggcctgtcgc tgcttgatct accagcggat       600
     gcattcgaaa aaaccatccg cactaatctc ctggcggctt tccatctgta ccaagtcttc       660
     ttgcctggca tcatcgcagc agagagcgga ggaacccttg ccacagtcag ctccgtgctg       720
     ggccagctga gtgctgcagg cctgtcagac tacgcagcaa gcaaagccgg acttagtgcg       780
     ctgcatcgga cgatagaagc ggaaattcgg ggtaacccgt tgatcaagac attactggtg       840
     gaagttgggc agatgtcgac gccattgttc gactgggtgc gcgcgccgaa caatttcttt       900
     gcgccagtct tggaaccggt cgaagtcgcc cgggagatgg tggcagcgat tgatagcggt       960
     cgaggtggtg tgatcagatt gcctatttat gcaaagctcg tgaattggta tgccgtgctg      1020
     cccgctacgg tgcagcgggt cgcgagatat ctgagtggaa tcgatgctgc cgtgaatcaa      1080
     agccgggaga catctgggaa gacagattga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page